triangle PDBeMotif: 1s3d  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.20.4.1
Classification oxidoreductase    | release date: Tue, Jan 13, 2004
Title arsenate reductase r60a mutant from e. coli
Authors B.F.EDWARDS, S.DEMEL
Method X-RAY DIFFRACTION (resolution: 1.54Å)
PDBe Citation   
Small molecules:    search CS CS binding statistics CS   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLI
DFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARSENATE REDUCTASE
member of: CATH:search3.40.30.10GENE3D:searchG3DSA_3.40.30.10PANTHER:searchPTHR30041/searchPTHR30041_SF0PFAM:searchPF03960PROSITE PROFILES:searchPS51353, SUPERFAMILY:searchSSF52833TIGRFAMS:searchTIGR00014UniProt:searchP08692
JMol viewer RasMol script viewer  CS 405A  ..                                                                                                                             *            
JMol viewer RasMol script viewer  CS 404A  ..                                                                                                                     *       |      *     
JMol viewer RasMol script viewer  CS 403A  ..                                                             *                                                       |       |      |     
JMol viewer RasMol script viewer  CS 402A  ..                                   * *  *                    |                                                       |       |      |     
JMol viewer RasMol script viewer  CS 401A  ..                                   | |  |                    |                                                ** *   |       |      |     
JMol viewer RasMol script viewer  SO4 204A  ..                                   | |  |                    |                       *                        || |   |       |      |     
JMol viewer RasMol script viewer  SO4 203A  ..           *  *                    | |  |                    |                       |                   **   || |   |     * |      |     
JMol viewer RasMol script viewer  SO4 202A  ..           |  |                    | |  |                    |                       |    *             *||   || |   |     | |      |     
JMol viewer RasMol script viewer  SO4 201A  ..         ***  |                    | |  |                    |                       |    |*            *||   || |   |     | |      |     
sec str:  ....eeee...hhhhhhhhhhhhhh....eeee......hhhhhhhhhhhhh..hhhhh...hhhhhhh.......hhhhhhhhhhhhhhhh...eeee..eeee..hhhhhhhh........ee.....eee.......
sequence :  ..NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***  |  ||| | |   |  ||||  |        |  ||      | || |  ||  |     |||||              || ||      | ||    | | |||| | |      || |||   | |||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  ||^** |   |  ||||  |        |  ||      | |^**  ||  |     |||||              || ||      | ||    | | |||| | |      || |||   | |||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  ||    |   |  ^***  |        ^***|      | |  |  ||  |     |||||              || ||      | ||    | | |||| | |      ^***||   | |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |^*****   |  |^*****        |   |      | |  |  ||  |     |||||              || ||      | |^***** | |||| | |       | |||   | |||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |  |         |  | |            |   |      | |  |  ||  |     |||||              || ||      | |       | |||| | |       | |||   | ^*** 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      |  |         |  | |            |   |      | |  |  ||  |     |||||              || ||      | |       | |||| | |       *****   *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |         **** |            |   |      | |  |  ||  |     |||||              *****      | |       ****** | |       ****|   ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |            ***            |   |      ***  |  ||  |     ****|               |  |      | |           |  | |         ***     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                           |   |           ********      ****               ****      | |           ******                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                     *****                                                      | |                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                ***                                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARSENATE REDUCTASE
member of: CATH:search3.40.30.10GENE3D:searchG3DSA_3.40.30.10PANTHER:searchPTHR30041/searchPTHR30041_SF0PFAM:searchPF03960PROSITE PROFILES:searchPS51353, SUPERFAMILY:searchSSF52833TIGRFAMS:searchTIGR00014UniProt:searchP08692
JMol viewer RasMol script viewer  CS 405A  ..                                                                *                                                            *            
JMol viewer RasMol script viewer  CS 404A  ..                                                                |                                                    *       |      *     
JMol viewer RasMol script viewer  CS 403A  ..                                                             *  |                                                    |       |      |     
JMol viewer RasMol script viewer  CS 402A  ..                                   * *  *                    |  |                                                    |       |      |     
JMol viewer RasMol script viewer  CS 401A  ..                                   | |  |                    |  |                                             ** *   |       |      |     
JMol viewer RasMol script viewer  SO4 204A  ..                                   | |  |                    |  |                    *                        || |   |       |      |     
JMol viewer RasMol script viewer  SO4 203A  ..           *  *                    | |  |                    |  |                    |                   **   || |   |     * |      |     
JMol viewer RasMol script viewer  SO4 202A  ..           |  |                    | |  |                    |  |                    |    *             *||   || |   |     | |      |     
JMol viewer RasMol script viewer  SO4 201A  ..         ***  |                    | |  |                  * |  |                    |    |*            *||   || |   |     | |      |     
sec str:  ....eeee...hhhhhhhhhhhhhh....eeee......hhhhhhhhhhhhh..hhhhh...hhhhhhh.......hhhhhhhhhhhhhhhh...eeee..eeee..hhhhhhhh........ee.....eee.......
sequence :  ..NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***  |  ||| | |   |  ||||  |        |  ||      | || |  ||  |     |||||              || ||      | ||    | | |||| | |      || |||   | |||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  ||^** |   |  ||||  |        |  ||      | |^**  ||  |     |||||              || ||      | ||    | | |||| | |      || |||   | |||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  ||    |   |  ^***  |        ^***|      | |  |  ||  |     |||||              || ||      | ||    | | |||| | |      ^***||   | |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |^*****   |  |^*****        |   |      | |  |  ||  |     |||||              || ||      | |^***** | |||| | |       | |||   | |||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |  |         |  | |            |   |      | |  |  ||  |     |||||              || ||      | |       | |||| | |       | |||   | ^*** 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      |  |         |  | |            |   |      | |  |  ||  |     |||||              || ||      | |       | |||| | |       *****   *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |         **** |            |   |      | |  |  ||  |     |||||              *****      | |       ****** | |       ****|   ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |            ***            |   |      ***  |  ||  |     ****|               |  |      | |           |  | |         ***     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                           |   |           ********      ****               ****      | |           ******                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                     *****                                                      | |                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                ***                                       

   New search    1s3d:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML