triangle PDBeMotif: 1rpu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification rna binding protein/rna    | release date: Wed, Dec 3, 2003
Title crystal structure of cirv p19 bound to sirna
Authors G.SZITTYA, J.BURGYAN, J.M.VARGASON, T.M.T.HALL
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 19 KDA PROTEIN
member of: PFAM:searchPF03220PRODOM:searchPD005743SUPERFAMILY:searchSSF103145UniProt:searchQ66104
sec str:  ...hhhhhhhhhh...................hhhhhhhhh.......eeeeeeee..eeeeeeee...hhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeee..eeeeeeee..hhhhhhhhhhhhhhhhhh......
sequence :  ..NDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDE..NPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEV
seq num:  ..8         18        28        38         ..55        65        75        85        95        105       115       125       135       145     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***    |  | |    | | |   | | |  ||  ||  ..           | |        | |   |  |||||| |     || ||| |  |   |||  |    | |    |         |  || |||  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |  | |    | | |   | | |  ||  ||  ..           | |        | |   |  |||||| |     || ||| |  |   |||  |    | |    |         |  || |||  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  | |    | | |   | | |  ||  ||  ..           | |        | |   |  |||||| |     || ||| |  |   ^**  |    | |    |         |  || |||  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  | |    | | |   | | ^***|  ||  ..           | |        | |   |  |||||| |     || ||| |  |    |   |    | |    |         ^***| ||^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |  | ^***** | |   | | |   |  ||  ..           | |        | |   |  ||^*****     || ||| |  ^*****   ^***** ^*****            || ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  |        | |   | | |   *****  ..           | |        | |   |  || ||| |     *****| |                                    || ||     
search RasMol script viewer Motif-ligand binding stats  asxturn ..        |  |        | |   *** |   |  |   ..           | |        ***   |  || ||| |     || ||| |                                    || ||     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****        | |       |   ****   ..           | |        | |   |  ****|| |     ****|| |                                    ****|     
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |       |   |      ..           | |        ***   |   |  || |      |  || |                                     |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***       |   |      ..           ***          |   |   ****| |      *******                                     ****     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                    | |       *****      ..                        *****       | |                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                  ..                                    ***                                                           

chain B : 19 KDA PROTEIN
member of: PFAM:searchPF03220PRODOM:searchPD005743SUPERFAMILY:searchSSF103145UniProt:searchQ66104
sec str:  ..hhhhhhhhhhh...................hhhhhhhhh.......eeeeeeee..eeeeeeee...hhhhhhhhh...hhhhhhhhhhh.......eeeeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh....
sequence :  ..NDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDE..NPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
seq num:  ..8         18        28        38         ..55        65        75        85        95        105       115       125       135       145  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***||  || ||||   | | |       |  ||      ..           | |        | |     || ||   |         | |   |   |||  |    | ||| || |  ||   |  || ||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  ||  || ||||   | | |       |  ||      ..           | |        | |     || ||   |         | |   |   |||  |    | ||| || |  ||   |  || ||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||  || ||||   | | |       |  ||      ..           | |        | |     || ||   |         | |   |   ^**  |    | ||| || |  ||   |  || ||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  ||  || ||||   | | |       ^***|      ..           | |        | |     || ||   |         | |   |    |   |    | ||| || |  ||   ^***| ||^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  ||  || ||^***** | |       |   |      ..           | |        | |     || ^*****         | |   ^*****   ^***** ^***** |  ||      || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****  ***** |     | |       |   |      ..           | |        | |     || ||             | |                    || || *****      || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****   ***** |     | |       |   |      ..           | |        | |     *****             | |                    ***** ****       ****|  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            ***     | |       |   |      ..           | |        | |                       | |                                      |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |       |   |      ..           | |        ***                       ***                                      |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***       |   |      ..           ***                                                                           ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                    | |       *****      ..                                                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                  ..                                                                                               

chain C : 5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3';
sec str:  .......................
sequence :  ..CGUACGCGUCACGCGUACGUU
seq num:  ..1         11         

chain D : 5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3';
sec str:  .......................
sequence :  ..CGUACGCGUCACGCGUACGUU
seq num:  ..1         11         

   New search    1rpu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors