triangle PDBeMotif: 1rpj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification periplasmic sugar receptor    | release date: Thu, Feb 4, 1999
Title crystal structure of d-allose binding protein from escherichia coli
Authors B.CHAUDHURI, S.L.MOWBRAY, T.A.JONES
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search SO4 SO4 binding statistics SO4   search ALL ALL binding statistics ALL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
AAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIFASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARA
WKKGIYLVNLDEKIDMDNLKKAGGNVEAFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATEAFK
KASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGKTGKVLVVGTDGIPEARKMVEAGQ
MTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPEFKLVDSILVTQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (PRECURSOR OF PERIPLASMIC SUGARRECEPTOR);
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_3.40.50.2300PANTHER:searchPTHR32196/searchPTHR32196_SF9PFAM:searchPF13407SUPERFAMILY:searchSSF53822UniProt:searchP39265
JMol viewer RasMol script viewer  ALL 291A  ..        *   * **                         *                                                **                                                      *   *                       *                         *                         *                   *                                         
JMol viewer RasMol script viewer  SO4 290A  ..        |   | ||                         |                                                ||                                                      |   |                   *   |   *   *  *              |                         |                   |                                         
JMol viewer RasMol script viewer  ZN 289A  ..*       |   | ||                         |                                                ||                                                      |   |                   |   |   |   |  |              |                         |                   |                                         
sec str:  .....eeeeeee...hhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhh....eeee........hhhhhhhhhh..eeeee.....hhhhhh......eeeee.hhhhhhhhhhhhhhhh....eeeeeee.....hhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhh.......eeeeee..hhhhhhhhh....eeee..hhhhhhhhhhhhhhhhhh..........eeeee..eeee.
sequence :  ..AAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIFASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARAWKKGIYLVNLDEKIDMDNLKKAGGNVEAFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATEAFKKASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGKTGKVLVVGTDGIPEARKMVEAGQMTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPEFKLVDSILVTQ
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | ||                | |      |  |            || |          | |        || |||    | |  |   || |||    |   | | ||    |      |    |      | |^***|  | | |  || || |       | ||   ||   |     |  |      ^***  |   ||| |||||||      |    |    ||||  |                  |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | ||                | |      |  |            || |          | |        || |||    | |  |   || |||    |   | | ||    |      |    |      | ||   |  | | |  |**^* |       | ||   ||   |     |  |            |   ||| |||||||      |    |    ||||  |                  |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||                | |      |  |            |^**          | |        || |||    | |  |   || |||    |   | | ||    |      |    |      | ||   |  | | |  |  |  |       | ||   ||   |     |  |            |   ||| |||^**|      |    |    ||||  |                  |  ^**  |  |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | ||                | |      ^***            |  |          | |        || |||    | |  |   || |||    |   | | ||    |      |    |      | ||   |  | | |  |  |  |       | ||   ||   |     |  |            |   ||| ||||| |      |    |    ||||  |                  |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ||                | |                      |  |          | |        || |||    | |  |   || ||^*****   | | |^*****      ^*****      | ^*****  | ^*****  |  |       | ||   ||   |     |  |            ^*****| ||||| |      ^*****    |^*****                  |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..         | ||                | |                      |  |          | |        || |||    | |  |   || |||        | | |                        |  |      |   |  |  |  |       | ||   ||   |     |  |                ********| |                ||||                     |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | ||                | |                      |  |          | |        || |||    | |  *****| |||        *****                        |  |      |   |  |  |  |       | |*****|   |     |  |                 || ||||| |                ||||                     |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | ||                | |                      |  |          | |        || |||    | |       | |||        ***                          |  |      |   |  |  |  |       | ||    |   |     |  |                 || ||||| |                ||||                     |  | |  |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | ||                | |                      |  |          | |        |****|    | |       ****|                                     |  |      |   |  |  |  |       ****    |   |     |  |                 |****||| |                ||||                     **** |  |  |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | ||                | |                      |  |          | |        |  | |    ***         | |                                     |  |      |   |  |  |  |       | |     |   |     |  |                 |  ||||| |                ||||                        | |  |  |              
search RasMol script viewer Motif-ligand binding stats  nest ..         | ||                ***                      |  |          | |        |  ***                ***                                     |  |      |   |  |  |  |       ***     |   |     |  |                 |  *******                ****                        ***  |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                                         ****          | |        |    |                                                        ****      |   |  *******               |   |     ****                 |   ***                                                    ****              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         | |                                                        | |        ******                                                                  |   |                        |   |                          ******                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..         | |                                                        | |                                                                                *****                        *****                                                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..         ***                                                        ***                                                                                                                                                                                                                         

   New search    1rpj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors