triangle PDBeMotif: 1rp1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.3
Classification hydrolase    | release date: Thu, Apr 2, 1998
Title dog pancreatic lipase related protein 1
Authors A.ROUSSEL, C.CAMBILLAU
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search CA CA binding statistics CA
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFI
DKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVA
GEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKK
NALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQGCPQMGHYADKFAVKTS
DETQKYFLNTGDSSNFARWRYGVSITLSGKRATGQAKVALFGSKGNTHQFNIFKGILKPGSTHSNEFDAKLDVGTIEKVK
FLWNNNVVNPTFPKVGAAKITVQKGEEKTVHSFCSESTVREDVLLTLTPC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PANCREATIC LIPASE RELATED PROTEIN 1
member of: CATH:search2.60.60.20/search3.40.50.1820GENE3D:searchG3DSA_2.60.60.20/searchG3DSA_3.40.50.1820PANTHER:searchPTHR11610/searchPTHR11610_SF93PFAM:searchPF00151/searchPF01477PIRSF:searchPIRSF000865PRINTS:searchPANCLIPASE/searchTAGLIPASEPROSITE PROFILES:searchPS50095, SMART:searchSM00308SUPERFAMILY:searchSSF49723/searchSSF53474UniProt:searchP06857
JMol viewer RasMol script viewer  CA 501A  ..                                                                                                                                                                                           *  * *  *                                                                                                                        ..CA ..                                                                                   ..                                          
JMol viewer RasMol script viewer  NAG 500A  ..                                                                                                                                           *                                               |  | |  |                                                                                                                        ..NAG ..                                                                                   ..                                          
sec str:  ...eeee...eeee.........................eeeeee.......eee....hhhhh........eeeeee..........hhhhhhhhhhh...eeeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeehhhhhhhhhhhh......eeeee......................eeeee.....................eeeee...................hhhhh........hhhhhhhhhhhhhhh............hhhhh.......................... ...eeee..........eeeeeeeeeee..eeeeeeeeeee.......eeeeeeee....eeeeeeee......eeeeeeeeee.........eeeeeeeeee....................eeee..
sequence :  ..KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQGCPQMGHYADKFA... ..QKYFLNTGDSSNFARWRYGVSITLSGKRATGQAKVALFGSKGNTHQFNIFKGILKPGSTHSNEFDAKLDVGTIEKVKFLWNNN..NPTFPKVGAAKITVQKGEEKTVHSFCSESTVREDVLLTLTPC
seq num:  ..1         11        21        30        40        50        59        69        79        89        99        109       119       129       139       149       159       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310   ... ..323       333       343       353       363       373       383       393          ..409       419       429       438         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |  | || || |              | |     | ||  |         | |||| ||| |        | | |||         |  ||         | ||   |          |    |       ^*** |  |    ||||||| | ||  |      |  | |||||| | || |   |  |       | |    | |  | |           | || ||   |        |  ||||      |  | |                  | | | ||||   |  |      || || ..PS00001.. ||        | |    |    || ||||        |    |    ||    | ||   |      | |  ||        ..               |  | |     | || || |       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |  | || || |              | |     | ||  |         | |||| ||| |        | | |||         |  ||         **^*   |          |    |        | | |  |    ||||||| | ||  |      |  | |||||| | || |   |  |       | |    | |  | |           | || ||   |        |  ||||      |  | |                  | | | ||||   |  |      || || ..PS00004.. ||        | |    |    || **^*        |    |    ||    | ||   |      | |  ||        ..               |  | |     | || || |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |  | || || |              | |     ^**|  |         | |||| ||^**        | | |||         |  ||         | ||   |          |    |        | | |  |    ||||||| | ||  |      |  | |||||| | || |   |  |       | |    | |  | |           | || ||   |        |  ||||      |  ^**                  ^** | ^**|   |  |      || || ..PS00005..**|        | |    |    |^**|          |    |    ||    | ||   |      | |  ||        ..               |  | |     | |^**| |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |  ^*** || |              | |        |  |         | |||| ||  |        | | |||         |  ||         | ||   |          |    |        | | |  |    ||||||| | ||  |      ^*** |||||| ^*** |   ^***       | |    | |  | |           | || ||   |        |  ||||      |                       |   | ||||   |  |      || || ..PS00006..  |        | |    |    ||  |          |    |    ||    | ||   |      | |  ||        ..               |  | |     | |^*** |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | |  | || || |              | |        |  |         | |||| ||  |        | | |||         |  ||         | ||   |          |    |        | | |  |    ||||||| | ||  |         | |||||| | |  |              | |    | |  | |           | || ||   |        |  ||||      |                       |   | ||||   |  |      || || ..PS00007..**^        | |    |    ||  |          |    |    ||    | ||   |      | |  ||        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |  | || || |              | |        |  |         | |||| ||  |        | | |||         |  ||         | ^*****          ^*****        | | |  |    |||^***** ||  |         | |||||| | |  |              | |    | |  | |           | || ^*****        ^*****|      |                       |   | ||||   |  |      || || ..PS00008..           | |    ^*****|  |          ^*****    ||    | ^*****      | |  ||        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      | |  | || || |              | |        |  |         | |||| ||  |        | | |||         |  ||         |  |                            | | |  |    |||||||   ||  |         | |||||| | |  |              | |    | |  | |           | ||  |               ||||      |                       |   | ||||   |  |      || || ..PS00009..           | |          ^***                    ||    |  |          | |  ||        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  LIPASE_SER ..      | |  | || || |              | |        |  |         | |||| ||  |        | | |||         |  ||         |  |                            | | |  ******^***||   ||  |         | |||||| | |  |              | |    | |  | |           | ||  |               ||||      |                       |   | ||||   |  |      || || ..PS00120..           | |                                  ||    |  |          | |  ||        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |  | || || |              | |        |  |         *****| ||  |        | | |||         *****         |  |                            | | |  |    ||*****   ||  |         | |||||| | |  |              | |    | |  | |           | ||  |               ||||      |                       |   | ||||   |  |      || || ..alphabetamotif..           | |                                  ||    |  |          | |  ||        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |  | || || |              | |        |  |         | || | ||  |        | | |||         |  |          |  |                            | | |  |    ||||||    ||  |         | |||||| | |  |              | |    | |  | |           | ||  |               ||||      |                       |   | ||||   |  |      || || ..asxturn..           | |                                  ||    |  |          ***  ||        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |  | || || |              | |        |  |         | || | ||  |        | | |||         |  |          |  |                            | | |  |    ||||||    ||  |         | |||||| | |  |              | |    | |  | |           | ||  |               ||||      |                       |   | ||||   |  |      || || ..betabulge..           | |                                  **    |  |               **        ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  | || || |              | |        |  |         **** | ||  |        | ****|         ****          ****                            | | |  |    ******    |****         | |****| | |  |              | |    | |  | |           | |****               ||||      |                       |   | ||||   ****      ****| ..betaturn..           | |                                        ****                         ..               |  | |     | |  ****       
search RasMol script viewer Motif-ligand binding stats  nest ..      ***  | || || |              ***        |  |           |  | ||  |        |   ***                                                       *** |  |      |       |   |         | | |*** | |  |              | |    ***  | |           ***|  |               ****      |                       |   | ****              |  | ..nest..           ***                                        |  |                         ..               |  | |     | |  |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..           *********                         ****           **********        |                                                                 ****      |       |   |         | ******** ****              ***         ***              ****                ***      |                       |   |                   **** ..niche..           ***                                        ****                         ..               ******     ***  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |                                                 | |            |                                                                           |       |   |         |                                        | |                                           |                       *****                        ..stmotif..                                                                                   ..                          | |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                 | |            |                                                                           |       *****         |                                        | |                                           |                                                    ..ststaple..                                                                                   ..                          | |             
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                 ***            |                                                                           |                     |                                        ***                                           |                                                    ..stturn..                                                                                   ..                          ***             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                              *                                                                           *                     *                                                                                      *                                                    ..REP00000..                                                                                   ..                                          

   New search    1rp1:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors