triangle PDBeMotif: 1r9f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification viral protein/rna    | release date: Tue, Oct 28, 2003
Title crystal structure of p19 complexed with 19-bp small interfering rna
Authors D.J.PATEL, K.YE, L.MALININA
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search U U binding statistics U   search SO4 SO4 binding statistics SO4
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRF
FGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMAPIEVESNVSR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CORE PROTEIN P19
member of: PFAM:searchPF03220PRODOM:searchPD005743SUPERFAMILY:searchSSF103145UniProt:searchP11690
JMol viewer RasMol script viewer  SO4 160A  ..             * *         ..                                                                                                
JMol viewer RasMol script viewer  SO4 159A  ..   *         | |         ..                 * *                                                                            
JMol viewer RasMol script viewer  U 1C  ..   |        *|**       ..                 | |*                                                                           
sec str:  ...............hhhhhhhhhhhh.......eeeeeeee..eeeeeeee...hhhhhhhhhh..hhhhhhhhhhh.......eeeeeeee..eeeeeeee..hhhhhhhhhhhhhhhhhh..
sequence :  ..HMTSPFKLPDESPSWTEWRLHNDET..QDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMA
seq num:  ..25        35        45   ..53        63        73        83        93        103       113       123       133       143   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |   | | |  ||  |  ||.. |           | |        | |   |    |    |      |  |     |   |||  |    | ||  ||         |  ||  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |   | | |  ||  |  ||.. |           | |        | |   |    |    |      |  |     |   ^**  |    | ||  ||         |  ||  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |   | | ^***|  |  ||..**           | |        | |   |    |    |      |  |     |    |   |    | ||  ||         ^***|  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**** |   | | |   |  |  ||..             | |        | |   |    ^*****      |  |     ^*****   ^***** ^*****             |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |   | | |   |  *****..             | |        | |   |                |  |                      |  |              |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |   *** |   |  |  | ..             | |        | |   |                |  |                      |  |              |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |   | | |   |  **** ..             | |        | |   |                |  |                      ****              |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..   | |   | | |   |       ..             | |        ***   |                |  |                                        |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..   ***   *** |   |       ..             ***          |   |                ****                                        **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..   | |       *****       ..                          *****                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..   ***                   ..                                                                                                

chain B : 5'-R(*CP*GP*UP*AP*CP*GP*CP*GP*GP*AP*AP*UP*AP*CP*UP*UP*CP*GP*AP*UP*U)-3';
JMol viewer RasMol script viewer  U 1C  ..**                * 
sec str:  ......................
sequence :  ..CGUACGCGGAAUACUUCGAU
seq num:  ..1         11        

chain C : 5'-R(*UP*CP*GP*AP*AP*GP*UP*AP*UP*UP*CP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3';
JMol viewer RasMol script viewer  U 1C  ..*                * 
sec str:  .....................
sequence :  ..CGAAGUAUUCCGCGUACGU
seq num:  ..2         12       

   New search    1r9f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors