triangle PDBeMotif: 1qxt  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification luminescent protein    | release date: Mon, Sep 8, 2003
Title crystal structure of precyclized intermediate for the green fluorescent protein r96a variant (a)
Authors C.D.PUTNAM, C.J.KASSMANN, D.P.BARONDEAU, E.D.GETZOFF, J.A.TAINER
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK
QHDFFKSAMPEGYVQEATISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GREEN-FLUORESCENT PROTEIN
member of: CATH:search2.40.155.10GENE3D:searchG3DSA_2.40.155.10PFAM:searchPF01353PRINTS:searchGFLUORESCENTSUPERFAMILY:searchSSF54511UniProt:searchP42212
sec str:  ..hhhhhh..eeeeeeeeeee..eeeeeeeeeeee....eeeeeeee.......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee...................eeeeeeee....eeeeeeeeeee.....eeeeeeeeeeee...........eeeeeeeeee........eeeeeeeeeee..
sequence :  ..GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQEATISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |                              |  | | ^**    ^**        |   |  ||  |            |  |          ^**|||   || |               |  ||  |   ||||             |  | |    |       | |           | | |                  | || |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**                              |  | |                   |   |  ||  |            |  |          ^***||   ^***               |  ||  |   ||||             |  | |    |       | |           | | |                  | || |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                |  | |                   |   |  ||  |            |  |           |  |^*****                 |  ||  ^*****||             |  | ^*****       | |           | | |                  | || |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                |  | |                   |   |  ||  |            |  |           |  |                       |  ||  |   ||||             |  | |            | |           | | |                  ***| |              
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                                ******                   |   |  ||  |            |  |           |  |                       |  ||  |   ||||             ******            | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                   | |                   |   ****|  |            |  |           ****                       |  |****   ||||                | |            | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  nest ..                                   ***                   |   |   |  |            |  |                                      |  ||  |   ****                ***            ***           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         |   |   ****            ****                                      ********    ***                                             *****                  ******              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                         *****                                                                                                                                                                    

   New search    1qxt:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors