triangle PDBeMotif: 1puf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Tue, Jun 24, 2003
Title crystal structure of hoxa9 and pbx1 homeodomains bound to dna
Authors C.WOLBERGER, N.A.LARONDE-LEBLANC
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAK
Chain B sequence:
ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HOMEOBOX PROTEIN HOX-A9
member of: CATH:search1.10.10.60GENE3D:searchG3DSA_1.10.10.60PANTHER:searchPTHR24325/searchPTHR24325_SF9PFAM:searchPF00046PIRSF:searchPIRSF037109PRINTS:searchHOMEOBOXPROSITE PATTERNS:searchPS00027, PROSITE PROFILES:searchPS50071, SMART:searchSM00389SUPERFAMILY:searchSSF46689UniProt:searchP09631
sec str:  ......................hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAK
seq num:  ..193       203       213       223       233       243       253       263    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |   || |      |   |      |  |          |   |^***| |           |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |   |^**      |   |      |  |          |   | |^** |           |        
search RasMol script viewer Motif-ligand binding stats  HOMEOBOX_1 ..   |  |   |  |      |   |      |  |          ************************        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |   ****      |   |      |  |              | ||   |                    
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |   |  |      |   |      |  |              ***|   |                    
search RasMol script viewer Motif-ligand binding stats  niche ..   ****   ****      |   |      ****                 |   |                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                    *****                           *****                    

chain B : PRE-B-CELL LEUKEMIA TRANSCRIPTION FACTOR-1
member of: CATH:search1.10.10.60GENE3D:searchG3DSA_1.10.10.60PANTHER:searchPTHR11850/searchPTHR11850_SF58PFAM:searchPF00046PROSITE PATTERNS:searchPS00027, PROSITE PROFILES:searchPS50071, SMART:searchSM00389SUPERFAMILY:searchSSF46689UniProt:searchP40424
sec str:  ..........hhhhhhhhhhhhhhh......hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.....hhhhhh
sequence :  ..ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY
seq num:  ..233       243       253       263       273       283       293          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | |      |   |       |   |  |   ||| | | |          | | |********^
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |      |   |       |   |  |   |^***** |          | | | ||      
search RasMol script viewer Motif-ligand binding stats  HOMEOBOX_1 ..        | |      |   |       |   |  ************************ | | ||      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |      |   |       |   |      | | |   |            *****|      
search RasMol script viewer Motif-ligand binding stats  asxturn ..        ***      |   |       |   |      | | |   |              |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |   |       |   |      | | |   |              ****      
search RasMol script viewer Motif-ligand binding stats  nest ..                 |   |       |   |      *** |   |              |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |       |   |          |   |              ****      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 |   |       *****          |   |                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                      *****                        

chain D : 5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*AP*CP*GP*CP*T)-3';
sec str:  ......................
sequence :  ..ACTCTATGATTTACGACGCT
seq num:  ..1         11        

chain E : 5'-D(*TP*AP*GP*CP*GP*TP*CP*GP*TP*AP*AP*AP*TP*CP*AP*TP*AP*GP*AP*G)-3';
sec str:  ......................
sequence :  ..TAGCGTCGTAAATCATAGAG
seq num:  ..21        31        

   New search    1puf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors