triangle PDBeMotif: 1psn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.23.1
Classification hydrolase (acid proteinase)    | release date: Mon, Jan 23, 1995
Title the crystal structure of human pepsin and its complex with pepstatin
Authors M.FUJINAGA, M.M.CHERNAIA, M.N.G.JAMES, N.TARASOVA, S.C.MOSIMANN
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSM
TGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQ
SGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASEN
SDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQV
GLAPVA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPSIN 3A
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF239PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP0DJD7
sec str:  ...eeee.eee...eeeeeeee....eeeeeeee...............hhhhh.....hhh.........eeeee....eeeeeeeee.eee..eee..eeeeeeee....hhhh....eeee...hhh.hhh...hhhhhhh.......eeeee.........eeee....hhh.....eeee.......eeee.eeee..eeee....eeeee......eee.hhhhhhhhhh..............hhhhhh...eeeee..eeeee.hhhheeee..eeee.eee.........eeee.hhhh..eeeeee....eeeeee..
sequence :  ..VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | |               |  | ||    | | || || || |   ||| | || ^***        |    |       | || | ||  | ^***    |  | |        |  |           | |||| |       ^***|  |    |  |||||                              | ||  |  |  | |  |        || |||   ^***   |  || ^***    |  |    | ||||    |   |||      | |          |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | |               |  | ||    | | || || || |   ||| | ||  | |        ^*****       | ^*****|  ^*****    |  | |        |  |           | |||| |           |  |    ^*****||                              | ||  |  |  | |  |        || |^*****| |   |  ||  |      |  |    | ||||    ^*****|      | |          |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..          | |               ***^******** | || || || |   ||| | ||  | |                     |  | |  |            |  | |        |  |           | |||| |           |  |       || ||                              | ||  ***^********        || |||    | |   |  ||  |      |  |    | ||||        | |      | |          |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |                  | ||      | || || || |   ||| | ||  | |                     |  | |  |            |  | |        |  |           | |||| |           |  |       || ||                              | ||     |  | |           || |||    | |   |  ||  |      |  |    *****|        | |      | |          |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |                  ***|      | || || || |   *** | ||  | |                     |  | |  |            |  | |        |  |           | |||| |           |  |       || ||                              | ||     |  | |           || |||    | |   |  ||  |      |  |    | || |        | |      | |          |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |                  |  |      | || |**** |    |  | ||  | |                     **** |  |            |  | |        |  |           ****|| |           |  |       ****|                              ****     |  | |           |****|    | |   ****|  |      ****    **** |        | |      | |          |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                  |  |      | || |  |  |    |  | ||  | |                          |  |            |  | |        |  |             **** |           |  |        |  |                              ***      |  | |           |  ***    ***       |  |                |  |        | |      | |          |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                               ****      ******  ****    *******  ***                          ****            ******        ****                ***           ****        ****                                       ******           |    |              ****                ****        ***      | |          ****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                         | |                | |   | |                                                                                                                                                                  ******                                              | |      | |                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                ***   ***                                                                                                                                                                                                                      ***      ***                               

   New search    1psn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors