triangle PDBeMotif: 1prx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification antioxidant    | release date: Fri, Apr 3, 1998
Title horf6 a novel human peroxidase enzyme
Authors C.-H.YANG, H.-J.CHOI, S.-E.RYU, S.G.RHEE, S.W.KANG
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Modified residues:  search CSO CSO binding statistics CSO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL
AWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEI
LRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HORF6
member of: CATH:search3.30.1020.10/search3.40.30.10GENE3D:searchG3DSA_3.30.1020.10/searchG3DSA_3.40.30.10PANTHER:searchPTHR10681/searchPTHR10681_SF77PFAM:searchPF00578/searchPF10417PIRSF:searchPIRSF000239PROSITE PROFILES:searchPS51352, SUPERFAMILY:searchSSF52833UniProt:searchP30041
sec str:  ............eeee..eeeehhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhhhhhhh............eee....hhhhh...................eeeee.....eeeeee........hhhhhhhhhhhhhhhhh.....................hhhhhhh.......................
sequence :  ..LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |       ^***             |    | |  |   |            || |||        |  ||   |    | |||| | |       | |||| | ||||  |  |  || ||||       | |       |  | || |   |   |   |  | | |  | |  |    | || |                 | ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |        | |             |    | |  |   |            || |||        |  ||   |    | |||| ^**       | |||| | ||||  |  |  || |^**       | |       |  ^**| |   |   |   |  | | |  | |  |    | || |                 ^**|        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |        | |             |    | |  |   |            || |||        ^***|   |    | |||| | |       | |||| | ||||  |  |  || | |        | |       |  |  | |   |   |   |  | | ^*** |  |    | ^***                 | ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*****        | |             ^***** |  |   |            || |||            |   |    | |||| | |       | |||| | ||||  |  |  ^*****        | |       |  |  | |   |   |   |  | |      |  |    |  |                   | ||        
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. |  |        | |                    |  |   |            || |||            |   |    | |||| | |       | |||| | ||||  |  |   | |          | |       |  |  | |   |   |   |  | |      |  |    |  |                   ^***        
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |        | |                    |  |   |            || |||            |   |    | |||| | |       | |||| | ||||  |  |   | |          | |       |  |  ***   |   |   |  | |      |  |    |  |                   | |         
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |        | |                    |  |   |            *****|            |   |    ****|| | |       ****|| ****||  |  |   | |          | |       |  |        |   |   |  | |      ****    |  |                   | |         
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |        | |                    |  |   |               | |            |   |      | |*** |         ||||   ||||  |  |   ***          | |       |  |        |   |   |  | |      |  |    |  |                   | |         
search RasMol script viewer Motif-ligand binding stats  nest .. |  |        | |                    |  |   |               ***            |   |      ***  | |         ****   ****  |  |                ***       |  |        |   |   |  ***      |  |    |  |                   ***         
search RasMol script viewer Motif-ligand binding stats  niche .. ****        | |                    ****   |                              |   |           ***                      ****                          ****        |   |   |           ****    ****                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..             | |                       *****                              *****           | |                                                                *********                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                          ***                                                                                                                               

chain B : HORF6
member of: CATH:search3.30.1020.10/search3.40.30.10GENE3D:searchG3DSA_3.30.1020.10/searchG3DSA_3.40.30.10PANTHER:searchPTHR10681/searchPTHR10681_SF77PFAM:searchPF00578/searchPF10417PIRSF:searchPIRSF000239PROSITE PROFILES:searchPS51352, SUPERFAMILY:searchSSF52833UniProt:searchP30041
sec str:  ...............eeee..eeeehhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhhhhhhh............eee....hhhhh................eeeee.....eeeeee........hhhhhhhhhhhhhhhhh.....................hhhhhhh....eee..........eee...
sequence :  ..PGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAE..MPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       ..127       137       147       157       167       177       187       197       207       217     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||||  |       ^***||      || | |    |    |   |            |  | |        |  |        || |||| | |       | ||||   ||||| | ..| ||||       | | ||    |  | || |       |   |  | | |  | |  |    | || |               | ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||||  |        | |||      || | |    |    |   |            |  | |        |  |        || |||| ^**       | ||||   ||||| | ..| |^**       | | ||    |  ^**| |       |   |  | | |  | |  |    | || |               | ^**|        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||||  |        | |||      || | |    |    |   |            |  | |        ^***        || |||| | |       | ||||   ||||| | ..| ||||       | | ||    |  |  | |       |   |  | | ^*** |  |    | ^***               | ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |^*****        | |||      || | ^*****    |   |            |  | |                    || |||| | |       | ||||   ||||| | ..*****|       | | ||    |  |  | |       |   |  | |      |  |    |  |                 | ||||        
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | ||  |        | |||      || |           |   |            |  | |                    || |||| | |       | ||||   ||||| | ..| || |       | | ||    |  |  | |       |   |  | |      |  |    |  |                 | ^***        
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||  |        | |||      || |           |   |            |  | |                    || |||| | |       | ||||   ||||*** ..| || |       | | ||    |  |  ***       |   |  | |      |  |    |  |                 | |||         
search RasMol script viewer Motif-ligand binding stats  betabulge .. | ||  |        | |||      || |           |   |            |  | |                    || |||| | |       | ||||   ||||    ..| || |       | | **    |  |            |   |  | |      |  |    |  |                 | |||         
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ||  |        ****|      ****           |   |            **** |                    |****|| | |       ****||   ||||    ..| || |       | |       |  |            |   |  | |      ****    |  |                 ****|         
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | ||  |        | | |       | |           |   |               | |                    |  | |*** |         ||||   ||||    ..******       | |       |  |            |   |  | |      |  |    |  |                   | |         
search RasMol script viewer Motif-ligand binding stats  nest .. | ||  |        | | |       | |           |   |               ***                    |  ***  | |         ****   ****    ..             ***       |  |            |   |  ***      |  |    |  |                   ***         
search RasMol script viewer Motif-ligand binding stats  niche .. *******        | | |       ***           |   |                                      |    |  ***                        ..                       ****            |   |           ****    ****                               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                | | |                     |   |                                      ******                             ..                                       |   |                                                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                *****                     |   |                                                                         ..                                       |   |                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                | |                       *****                                                                         ..                                       *****                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***                                                                                                     ..                                                                                                  

   New search    1prx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML