triangle PDBeMotif: 1pmn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.
Classification transferase    | release date: Wed, Jun 11, 2003
Title crystal structure of jnk3 in complex with an imidazole- pyrimidine inhibitor
Authors G.SCAPIN, J.LISNOCK, J.W.BECKER, P.V.LOGRASSO, S.B.PATEL
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search 984 984 binding statistics 984
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MASKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV
KSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIE
QLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MITOGEN-ACTIVATED PROTEIN KINASE 10
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24055/searchPTHR24055_SF162PFAM:searchPF00069PRINTS:searchJNKMAPKINASEPROSITE PATTERNS:searchPS00108/searchPS01351, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP53779
JMol viewer RasMol script viewer  984 501A  ..                         * *     *            ***                              * *                 * *  ***                                         **           *     ..984 ..                                                                                                                                                           ..984 ..                      
sec str:  .....eeeeee..eeeeee..eeeeeeeee....eeeeeee....eeeeeeeee....hhhhhhhhhhhhhhhhhh.........eee..........eeeeeee...eehhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......... ................hhhhhh......hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhh.hhhhhhhhhh.......hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhh..... .........hhhhhhhhhhhhhhh
sequence :  ..DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLA... ..SFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAP... ..QLDEREHTIEEWKELIYKEVMN
seq num:  ..45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205    ... ..217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367  ... ..379       389         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |           |  |  |        |    | | || |    | || || ^***|        || || |  |   ||  | | || ||          ||    |  |  ||  ||            || ||| | | || || |  ||| |    |  ..PS00001..  | |    ||  ||  ||| |           |    |  | |                          |  |  | |  |  |             |  |                |  || | || ||||  ||  |  || ||| ||||  ..PS00001..       |  ||      |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|   |           |  |  |        |    | | || |    **^* || | | |        || || |  |   ||  | | || ||          ||    |  |  ||  ||            || ||| | | || || |  ||| |    |  ..PS00004..  | |    ||  ||  ||| |           |    |  | |                          |  |  | |  |  |             |  |                |  || | || **^*  ||  |  || ||| ||||  ..PS00004..       |  ||      |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |           |  |  |        |    | | || |         || | | |        || || |  |   ||  | | || ||          ||    |  |  ||  ||            || ||| | | || || |  ||^**    |  ..PS00005..  | |    ||  ||  ||| |           |    |  | |                          |  |  ^**  |  |             |  |                |  || | ||  | |  ||  |  || ||| ||||  ..PS00005..       |  ||      |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*   |           |  |  |        |    | | || |         || | | |        || || |  |   ||  | | ^***|          ||    |  |  ||  ||            || ||| | | || || |  |||      |  ..PS00006..  | |    ||  ||  ||| |           |    |  | |                          |  |       |  |             |  |                |  || | ||  | ^***|  |  || ||| ||||  ..PS00006..       ^***|      |  |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..****^           |  |  |        |    | | || |         || | | |        || || |  |   ||  | | ||  |          ||    |  |  ||  ||            || ||| | | || || |  |||      |  ..PS00007..  | |    ||  ||  ||| |           |    |  | |                          |  |       |  |             |  |                |  || | ||  |     |  |  || ||| ||||  ..PS00007..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  |  |        ^***** | || |         || | | |        || || |  |   ||  | | ||  |          ||    |  |  ||  ||            || ||| | | || || |  |||      ^**..PS00008..  | |    ||  ||  ||| |           ^*****  | |                          |  |       |  |             |  |                |  || | ||  |     |  |  || ||| ||||  ..PS00008..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..                |  |  |               | || |         || | | |        || || |  |   ||  | | ||  |          ||    |  |  ||  ||            || ||****^********  |||         ..PS00108..  | |    ||  ||  ||| |                   | |                          |  |       |  |             |  |                |  || | ||  |     |  |  || ||| ||||  ..PS00108..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  MAPK ..                |  |  |               | || |         |*******************************************************************************************************|         ..PS01351..  | |    ||  ||  ||| |                   | |                          |  |       |  |             |  |                |  || | ||  |     |  |  || ||| ||||  ..PS01351..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  |  |               | || |         |  | | |        || || |  |   ||  | | ||  |          ||    |  |  ||  ||            || ||| | | || ||    | |         ..alphabetamotif..  | |    ||  |*****| |                   | |                          |  |       |  |             |  |                ***** | ||  |     |  ***** ||*****|  ..alphabetamotif..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                |  |  |               | || |         |  *****        || || |  |   ||  | | ||  |          ||    |  |  *****|            || ||| | | || ||    | |         ..asxmotif..  | |    ||  ||  | | |                   | |                          |  |       |  |             |  |                |  |  | ||  |     |  |  || ||| || |  ..asxmotif..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |  |               ***| |         |  ***          || || |  |   ||  | | ||  |          ||    |  |   |   |            || ||| | | || ||    | |         ..asxturn..  | |    ||  ||  | | |                   | |                          |  |       |  |             |  |                |  |  | ||  |     |  |  || ||| || |  ..asxturn..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  |  |               |  | |         |  |            || || |  |   **  | | ||  |          **    |  |   |   |            || ||| | | || ||    | |         ..betabulge..  | |    ||  ||  | | |                   | |                          |  |       |  |             |  |                |  |  | ||  |     |  |  || ||| || |  ..betabulge..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                |  |  |               ******         |  |            || || |  |       | | ||  |                |  |   |   |            || ||| | | || ||    | |         ..betabulgeloop..  | |    ||  ||  | | |                   | |                          |  |       |  |             |  |                |  |  | ||  |     |  |  || ||| || |  ..betabulgeloop..       |   |      |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                |  |  |                  | |         |  |            ****| |  |       | | ||  |                ****   |   |            *****| | | || ||    | |         ..betaturn..  | |    ||  |**** | |                   | |                          ****       |  |             ****                ****  | ||  |     |  *******|**** |  ..betaturn..       |   |      ****
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |  |                  ***         |  |             |  | |  |       | | ||  |                |  |   |   |               *** *** || ||    ***         ..nest..  | |    ||  |     ***                   ***                          |  |       |  |             |  |                      | ||  |     |  |   |  |  |  |  ..nest..       |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                *******                              ****             **** ****       *** |****                ****   |   |                     | |****                ..niche..  ***    |****                                                        ****       ****             ****                      *******     ****   ****  ****  ..niche..       |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                          *****                       |   |                     | |  |                 ..stmotif..         |                                                                                                                                                 ..stmotif..       *****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                      *****                     | |  |                 ..ststaple..         |                                                                                                                                                 ..ststaple..                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                * *  *                 ..REP00000..         *                                                                                                                                                 ..REP00000..                      

   New search    1pmn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors