triangle PDBeMotif: 1pih  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification electron transfer(iron-sulfur protein)    | release date: Wed, Aug 3, 1994
Title the three dimensional structure of the paramagnetic protein hipip i from e.halophila through nuclear magnetic resonance
Authors C.LUCHINAT, D.H.W.KASTRAU, I.BERTINI, I.FELLI, L.BANCI, L.D.ELTIS, M.PICCIOLI, M.SMITH, R.PIERATTELLI
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search SF4 SF4 binding statistics SF4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||     |  ||  |  ||  ||| ||  |    | |   |^***|  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|     ***********|  |********    | |   | |  ****  **** |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |         |  |  ||  | |  |  |    ***   ***             |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |  ||  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    *********** *******                          ****    

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||     | |||| |   |  ||| ||  |    | |    ^***|| |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|     ********   ************    | |     *******  **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |         |  |   |  | |  |  |    ***       ||| |               
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |   |  | |  |  |              *** |               
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****   **** *******               ****               

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..             *                  *  * **          *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||       | || |  ||  ||  ||  |    | |    ^***||    |  |   | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|       ******  |************    | |     ****|    ****   | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |         |  |  ||  |    |  |    ***       | |           ***   
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |  ||  |    |  |              ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***********    ****                                  

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * **          *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||     |||||| |   |  ||| ||  |    | |   |^***|  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|     ********   |  |********    | |   | |  ****  **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |         |  |   |  | |  |  |    ***   ***  |  |       |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |   |  | |  |  |               |  |       |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****   **** *******               ****       ****    

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * **          *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||  || ||| || |  ||  ||| ||  |    |  |  |^***|| |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ********| |*******  |************    ****  | *******  **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |   | |   |  |  ||  | |  |  |          *** | |         |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   | |   |  |  ||  | |  |  |              ***         |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..              ***   *********** *******                          ****    

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *     * **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |      || || |   |  ||| ||  |    | |   |^***      |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |      *******   ************    | |   | |        **** |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |         |  |   |  | |  |  |    ***   | |             |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |   |  | |  |  |          ***             |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****   **** *******                          ****    

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * **          *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |     | |||| | | |  ||| ||  |    | |    ^***|  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |     | |||| | | |  |*****  |    | |        |  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |     ******** | |  |********    | |        ****  **** |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |         |  *** |  | |  |  |    ***                   |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |   |  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****   **** *******                          ****    

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |  || ||| || |  ||  ||| ||  |    | |    ^***      |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | ****| |*******  |************    | |              **** |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |   | |   |  |  ||  | |  |  |    ***                   |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   | |   |  |  ||  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..              ***   *********** *******                          ****    

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *     * **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||  || ||| || |  ||  ||| ||  |    | |   |^***      |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ********| |***** |  |************    | |   | |        **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |   | | |  | |  ||  | |  |  |    ***   ***             |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   | | |  | |  ||  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..              *** **** ******** *******                          ****    

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | ||| | | ||||||     |  ||| ||  |    | |    ^***|  |  |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****| | | ******     ************    | |        ****  **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | | | |            |  | |  |  |    ***                   |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        *** ***            |  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                           **** *******                          ****    

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..             *                  *  * **          *    *    *     * **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||   | ||| ||     |  ||| ||  |    | |    ^***|  |  |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|   | |****|     ************    | |        |  |  ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |   | | |  |     |  | |  |  |    ***        |  |               
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   | | |  |     |  | |  |  |               |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..              *** ****     **** *******               ****               

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *          * **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |  |    | || |   |  ||| ||  |    |  |  |^***||    |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | ****    ******   ************    ****  | ****|    **** |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***         |  |   |  | |  |  |          | | ***         |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****   **** *******          ***             ****    

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | | | | | || | |  ||  ||| ||  |    | |   |^***      |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | | | | ****** |  |************    | |   | |        **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | | | |   |  | |  ||  | |  |  |    ***   ***             |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        *** ***   |  | |  ||  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                  **** ******** *******                          ****    

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * *           *    *    *    ** **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | ||| ||| |||||| |   |  ||| ||  |||  | |   |^***      |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | ||| ||| |||||| |   |  ||| ||  |**  | |   | |        |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ********| ********   ************    | |   | |        **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | | | |     |  |   |  | |  |  |    ***   ***             |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        *** ***     |  |   |  | |  |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****   **** *******                          ****    

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH POTENTIAL IRON SULFUR PROTEIN
member of: CATH:search4.10.490.10GENE3D:searchG3DSA_4.10.490.10PFAM:searchPF01355PROSITE PROFILES:searchPS51373, SUPERFAMILY:searchSSF57652UniProt:searchP04168
JMol viewer RasMol script viewer  SF4 74A  ..                                *  * **          *    *    *     * **    
sec str:  ..................hhhhhhhh.......hhhh...eeeeee..eeee.hhhhhh..ee............
sequence :  ..ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPAS
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||  || ||  |  |  ||  ||  ||  |    | |    ^***      |  | |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ********| |*******  |************    | |              **** ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |   | |   |  |  ||  |    |  |    ***                   |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   | |   |  |  ||  |    |  |                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..              ***   ***********    ****                          ****    

   New search    1pih:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML