triangle PDBeMotif: 1pi8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification viral protein    | release date: Thu, May 29, 2003
Title structure of the channel-forming trans-membrane domain of virus protein "u" (vpu) from hiv-1
Authors A.A.MRSE, A.A.NEVZOROV, M.F.MESLEH, M.MONTAL, M.OBLATT-MONTAL, S.H.PARK, S.J.OPELLA
Method SOLID-STATE NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VPU PROTEIN
sec str:  ..hhhhhhhhhhhhhhhhhhh
sequence :  ..AIVALVVAIIIAIVVWSIV
seq num:  ..7         17       
search RasMol script viewer Motif-ligand binding stats  PS00009 .. | |||||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *******           
search RasMol script viewer Motif-ligand binding stats  betaturn .. ******            

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VPU PROTEIN
sec str:  ..hhhhhhhhhhhhhhhhhhh
sequence :  ..AIVALVVAIIIAIVVWSIV
seq num:  ..7         17       
search RasMol script viewer Motif-ligand binding stats  PS00009 .. | |||||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *******           
search RasMol script viewer Motif-ligand binding stats  betaturn .. ******            

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VPU PROTEIN
sec str:  ..hhhhhhhhhhhhhhhhhhh
sequence :  ..AIVALVVAIIIAIVVWSIV
seq num:  ..7         17       
search RasMol script viewer Motif-ligand binding stats  PS00009 .. | |||||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *******           
search RasMol script viewer Motif-ligand binding stats  betaturn .. ******            

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VPU PROTEIN
sec str:  ..hhhhhhhhhhhhhhhhhhh
sequence :  ..AIVALVVAIIIAIVVWSIV
seq num:  ..7         17       
search RasMol script viewer Motif-ligand binding stats  PS00009 .. | |||||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *******           
search RasMol script viewer Motif-ligand binding stats  betaturn .. ******            

   New search    1pi8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML