triangle PDBeMotif: 1pfi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification virus    | release date: Wed, Apr 6, 1994
Title pf1 virus structure: helical coat protein and dna with parax phosphates
Authors D.J.LIU, L.A.DAY
Method FIBER DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAJOR COAT PROTEIN OF PF1 VIRUS
member of: CATH:search1.20.5.230GENE3D:searchG3DSA_1.20.5.230PFAM:searchPF05356PRODOM:searchPD059964SUPERFAMILY:searchSSF57987UniProt:searchP03621
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
seq num:  ..1         11        21        31        41    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |^***|||||||  |  || || ||||||||||| |||||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****||||||||||  |  || || |||||||||^*****||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ************  ***** || |******************
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ************  ****************************

chain B : MAJOR COAT PROTEIN OF PF1 VIRUS
member of: GENE3D:searchG3DSA_1.20.5.230PFAM:searchPF05356PRODOM:searchPD059964SUPERFAMILY:searchSSF57987UniProt:searchP03621
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
seq num:  ..1         11        21        31        41    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |^***|||||||  |  || || ||||||||||| |||||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****||||||||||  |  || || |||||||||^*****||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ************  ***** || |******************
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ************  ****************************

chain C : 2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE
sec str:  ...
sequence :  ..C
seq num:  ..1

chain D : 2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE
sec str:  ...
sequence :  ..C
seq num:  ..1

   New search    1pfi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML