triangle PDBeMotif: 1pe0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Tue, May 20, 2003
Title crystal structure of the k130r mutant of human dj-1
Authors L.TONG, X.TAO
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQ
NLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGT
SFEFALAIVEALNGKEVAAQVKAPLVLKDLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DJ-1
member of: CATH:search3.40.50.880GENE3D:searchG3DSA_3.40.50.880PANTHER:searchPTHR11019/searchPTHR11019_SF4PFAM:searchPF01965SUPERFAMILY:searchSSF52317TIGRFAMS:searchTIGR01383UniProt:searchQ99497
sec str:  .....eeeeee....hhhhhhhhhhhhhhh..eeeeee......ee.....eee..eehhhhhhh....eeee..hhhhhhhhhhhhhhhhhhhhhhhh..eeeee...hhhhhhh......ee..hhhhhhhhh.....ee....eeee..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..ASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |     |  |           || |||   |    | |     | |      |  ||  |         |    | ^***|            | |    |   |  || |||||||   ||  |  | |||| ||||||     |   ||||  |  |                     | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**     |  |           || |||   |    | |     | |      |  ||  |         |    |  |  |            | |    |   |  || |||||||   ||  |  | |||| ||||||     |   ^**|  |  |                     | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |           || |||   |    | |     | |      ^***|  |         |    |  |  |            | |    |   |  || |||||||   ||  |  | |||| |^***|     |    | |  ^***                     | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |           || |^*****    | |     | |      |   |  |         ^*****  |  |            | ^*****   |  || |||||^*****|  |  | ||^*****| |     ^***** |  |                        | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |           || |||        | |     | |      |   |  |                 |  |            | |        ***** ||||| |    |  |  | || | |  | |            |  |                        | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****           |****|        | |     | |      |   ****                 |  |            | |        ********|****    ****  | **** |  | |            ****                        | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |           |  ***        | |     ***      |   |                    |  |            ***           |  ***|| |          |  | ***  | |                                        *** 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****           |    |        ***              |   |                    ****                          |   ******          ****      ***                                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                        ******                         |   |                                                  ******                        | |                                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                       *****                                                                                | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                            ***                                            

chain B : DJ-1
member of: CATH:search3.40.50.880GENE3D:searchG3DSA_3.40.50.880PANTHER:searchPTHR11019/searchPTHR11019_SF4PFAM:searchPF01965SUPERFAMILY:searchSSF52317TIGRFAMS:searchTIGR01383UniProt:searchQ99497
sec str:  .....eeeeee....hhhhhhhhhhhhhhh..eeeeee......ee.....eee..eehhhhhh.....eeee..hhhhhhhhhhhhhhhhhhhhhhhh..eeeee..hhhhhhhh......ee..hhhhhhhhh.....ee....eeee..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..ASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK
seq num:  ..202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |     |  |           |  |||   |    | |     | |      |  ||            |    | ^***|            | |    |   |  || |||||||   ||  |  |  ||| ||||||     |   ||||  |  |                     | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**     |  |           |  |||   |    | |     | |      |  ||            |    |  |  |            | |    |   |  || |||||||   ||  |  |  ||| ||||||     |   ^**|  |  |                     | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |           |  |||   |    | |     | |      ^***|            |    |  |  |            | |    |   |  || |||||||   ||  |  |  ||| |^***|     |    | |  ^***                     | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |           |  |^*****    | |     | |      |   |            ^*****  |  |            | ^*****   |  || |||||^*****|  |  |  |^*****| |     ^***** |  |                        | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |           |  | |        | |     | |      |   |                    |  |            | |        ***** ||||| |    |  |  |  | | |  | |            |  |                        | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****           **** |        | |     | |      |   |                    |  |            | |        ********|****    ****  |  | | |  | |            ****                        | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |              ***        | |     ***      |   |                    |  |            ***           |  ***|| |          |  | ***  | |                                        *** 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                         ***              |   |                    ****                          |   ******          ****      ***                                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                       |   |                                                  ******                        | |                                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                       *****                                                                                | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                            ***                                            

   New search    1pe0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors