triangle PDBeMotif: 1p4k  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.5.1.26
Classification hydrolase    | release date: Wed, Apr 23, 2003
Title crystal structure of the glycosylasparaginase precursor d151
Authors C.GUAN, H.C.GUO, X.QIAN
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVA
CMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDA
QGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIV
KIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASE
member of: PANTHER:searchPTHR10188/searchPTHR10188_SF6PFAM:searchPF01112SUPERFAMILY:searchSSF56235UniProt:searchQ47898
JMol viewer RasMol script viewer  GOL 297A  ..                                                                                                                                                     * *                 * *       * ***                   * *                                                                                         
JMol viewer RasMol script viewer  GOL 296A  ..                                                                                                                                                     * *                 * **      * ***                   | *                                                                                         
sec str:  .......eeeee..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...................eeeeee.....eeeeeee....hhhhhhhhhhhhh...eeehhhhhhhhhhh........hhhhhhhhhhhhh...............eeeeee.....eeeeeee....................eeee...eeeeeeehhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeeee....eeeee......eeeee..eeeee..ee...
sequence :  ..TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVACMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDAQGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIVKIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |      |  |    |  |  |||||            |  | ||||||  |  | | |        | |   |    |  |         ||  | |    |  ||   | |||   | ||  ||||      | |     | |   |      | ||^***|  | ||  ||  |  |  | | |   | |||    ||   |   ||||        | ||   |   |  ||    | |||||| |       |||||   |  |  |     | |||      | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**      |  |    |  |  |||||            |  | ^**|||  |  | | |        | |   |    |  |         ||  | |    |  ||   | |||   | ||  ^**|      | |     | |   |      | |||   |  | ||  ||  |  |  | | |   | |||    ||   |   ||||        | ||   |   |  ||    | |||||| |       |||||   |  |  |     | |||      | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |    |  |  |||||            |  | || |||  |  | | |        | |   |    |  |         ||  | |    |  ||   | |||   | ||  ^***      | |     | |   |      | |||   |  | ||  ||  |  |  | | |   | |||    ||   |   ||||        | ||   |   |  ||    | |||||| |       |||||   |  |  |     | |||      | | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |    |  |  |||||            |  | || |||  |  | | |        | |   |    |  |         ||  | |    |  ||   | |||   | ||   |        | |     | |   |      | |||   |  | ||  ||  |  |  | | |   | |||    ||   |   ||||        | ||   |   |  ||    | |||||| |       |*******^  |  |     | |||      | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  ^*****  |  |||||            |  | || |||  |  | | |        | |   ^*****  |         ||  | |    |  ||   | |||   | ||   |        | |     | |   |      | |^*****  | ||  ||  |  |  | | |   | ||^*****|   |   ||||        | ||   |   |  ||    | |||||| |       | |||      |  |     | |||      | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |       |  |||||            |  | || |||  |  | | |        | |        |  |         ||  | |    *****   | |||   | ||   |        | |     | |   |      | |||      | ||  ||  |  |  | | |   *****    ||   |   ||||        | ||   |   *****    | |||||| |       | |||      |  |     | |||      | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  |       |  |||||            |  | || |||  |  | | |        | |        |  |         ||  | |    |  |    | |||   | ||   |        | |     | |   |      | |||      | ||  ||  |  |  | | |   *****    ||   |   ||||        | ||   |   |  |     | |||||| |       | |||      |  |     *****      | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |       |  |||||            |  ***| |||  |  *** |        ***        |  |         ||  | |    |  |    | |||   ***|   |        | |     | |   |      | |||      | ||  ||  |  |  | | |   ***|     ||   |   ||||        | ||   |   |  |     | |||*** |       | |||      |  |     ***|       | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          |  |       |  |||||            |  |  | |||  |    | |                   |  |         ||  | |    |  |    | |||   | ||   |        | |     | |   |      *****      | ||  ||  |  |  | | |   |  |     ||   |   ||||        | ||   |   |  |     | ||| |  |       *****      |  |     |  |       | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****       |  ****|            |  |  | ||****    | |                   |  |         ||  | |    ****    ****|   | ||   |        | |     | |   |      ****|      | ||  |****  |  | | |   ****     ||   |   ||||        | ||   |   ****     ****| ****       ****|      |  |     ****       | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                     |   |***            |  |  | |||  |    ***                   |  |         ||  | |              ***   | ||   |        ***     | |   |        ***      | ||  ||  |  |  | ***            ||   |   ****        ***|   |              *** |  |         ***      |  |                | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                     |   |               **************                          ****         |**** |                    ***|   |                ***   |                 | |********  ****                ||   |   |              |   |                  ****                  ****                *** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |   |                       |                                            |   | |                       *****                      |                 | |                              ||   |   |              *****                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****                       |                                            ***** |                                                  |                 | |                              ||   *****                                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 |                                                ***                                                  |                 ***                              ||                                                                                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                 *                                                                                                     *                 *                                **                                                                                           

chain C : N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASE
member of: PANTHER:searchPTHR10188/searchPTHR10188_SF6PFAM:searchPF01112SUPERFAMILY:searchSSF56235UniProt:searchQ47898
JMol viewer RasMol script viewer  GOL 4C  ..                                                                                                                                                     * *                 *         * ***                   * *                                                                                         
JMol viewer RasMol script viewer  GOL 2C  ..                                                                                                                                                     * *                 * *       * ***                   | *                                                                                         
sec str:  .......eeeee..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...................eeeeee.....eeeeeee....hhhhhhhhhhhhh...eeehhhhhhhhhhh........hhhhhhhhhhhhh...............eeeeee.....eeeeeee....................eeee...eeeeeeehhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeeee....eeeee......eeeee..eeeee..ee...
sequence :  ..TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDRDGRVTLDACIMDENYNIGSVACMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGFKKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDAQGNLSGACTTSGMAYKMHGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAVERIVKIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
seq num:  ..301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |         |    |     | |||            |  | ||||||  |  | | |        | |   | |  |  |         ||  | |              | |   | ||  ||||      | |     |  |  |      | ||^***|  | ||  ||  |  |  | | |   | |||    ||   |   ||||     || ||||   |            | |||||| |       |||||   |  |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**         |    |     | |||            |  | ^**|||  |  | | |        | |   | |  |  |         ||  | |              | |   | ||  ^**|      | |     |  |  |      | |||   |  | ||  ||  |  |  | | |   | |||    ||   |   ||||     || ||||   |            | |||||| |       |||||   |  |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             |    |     | |||            |  | || |||  |  | | |        | |   | |  |  |         ||  | |              | |   | ||  ^***      | |     |  |  |      | |||   |  | ||  ||  |  |  | | |   | |||    ||   |   ||||     || ||||   |            | |||||| |       |||||   |  |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             |    |     | |||            |  | || |||  |  | | |        | |   | |  |  |         ||  | |              | |   | ||   |        | |     |  |  |      | |||   |  | ||  ||  |  |  | | |   | |||    ||   |   ||||     || ||||   |            | |||||| |       |*******^  |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             ^*****     | |||            |  | || |||  |  | | |        | |   ^*****  |         ||  | |              | |   | ||   |        | |     |  |  |      | |^*****  | ||  ||  |  |  | | |   | ||^*****|   |   ||||     || ||||   |            | |||||| |       | |||      |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        | |||            |  | || |||  |  | | |        | |     |  |  |         ||  | |              | |   | ||   |        | |     |  |  |      | |||      | ||  ||  |  |  | | |   *****    ||   |   ||||     || ||||   |            | |||||| |       | |||      |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                        | |||            |  | || |||  |  | | |        | |     |  |  |         ||  | |              | |   | ||   |        | |     |  |  |      | |||      | ||  ||  |  |  | | |   *****    ||   |   ||||     || ||||   |            | |||||| |       | |||      |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..                        | |||            |  ***| |||  |  *** |        ***     |  |  |         ||  | |              | |   | ||   |        | |     |  |  |      | |||      | ||  ||  |  |  | | |   ***|     ||   |   ||||     || ||||   |            | |||*** |       | |||      |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                        | |||            |  |  | |||  |    | |                |  |  |         ||  | |              | |   | ||   |        | |     |  |  |      *****      | ||  ||  |  |  | | |   |  |     ||   |   ||||     || ||||   |            | ||| |  |       *****      |  |     |  |       ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        ****|            |  |  | ||****    | |                |  |  |         ||  | |              | |   | ||   |        | |     ****  |      ****|      | |********  |  | | |   ****     ||   |   ||||     |****||   |            ****| |  |       ****|      |  |     ****       ||||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                          | |            |  |  | |||  |    | |                |  |  |         ||  | |              | |   | ||   |        | |     |  |  |        | |      | ||  ||  |  |  | | |            ||   |   ||||     |  | ||   |              | | |  |         | |      |  |                |***
search RasMol script viewer Motif-ligand binding stats  nest ..                          ***            |  |  | |||  |    ***                |  |  |         ||  | |              ***   | ||   |        ***     |  |  |        ***      | ||  ||  |  |  | ***            ||   |   ****     |  ***|   |              *** |  |         ***      |  |                | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                         **************                       *******         |**** |                    ***|   |                ****  |                 | |********  ****                ||   |   |        |    ||   |                  ****                  ****                *** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                 |                                            |   | |                       |   |                      |                 | |                              ||   |   |        ******|   |                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                 |                                            |   | |                       *****                      |                 | |                              ||   |   |              *****                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 |                                            ***** |                                                  |                 | |                              ||   *****                                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 |                                                ***                                                  |                 ***                              ||                                                                                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                 *                                                                                                     *                 *                                **                                                                                           

   New search    1p4k:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors