triangle PDBeMotif: 1oxd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification luminescent protein    | release date: Wed, Apr 2, 2003
Title expansion of the genetic code enables design of a novel "gol of green fluorescent proteins
Authors A.ZUMBUSCH, G.JUNG, G.WIEGAND, J., J.HYUN BAE, L.MORODER, M.H.SEIFERT, M.K.AZIM, M.RUBINI, N.BUDISA, R.HUBER, T.A.HOLAK
Method X-RAY DIFFRACTION (resolution: 1.15Å)
PDBe Citation   
Modified residues:  search CRF CRF binding statistics CRF
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKR
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYAN FLUORESCENT PROTEIN CFP
member of: CATH:search2.40.155.10GB:search11321072
sec str:  ....hhhhhhh..eeeeeeeeeee..eeeeeeeeeeeehhh.eeeeeeee.......hhhhhh......hhhhh..hhhhhhhhhhhhh....eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee....................eeeeeeehhhheeeeeeeeeee.....eeeeeeeeeeee...........eeeeeeeeee........eeeeeeeeeee..
sequence :  ..MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWG..VQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
seq num:  ..1         11        21        31        41        51        61   ..68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |                |  |          || ||| ^**    ^**    |  |     ..|| ||  |  |      |  |           |  ||   || |    | |        |  ||  ||| ||||     | |     || |||    |       | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***                |  |          || |||               |  |     ..|| ||  |  |      |  |           |  ||   ^***    | |        |  ||  ||| ||||     | |     || |||    |       | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     |  |          || |||               |  |     ..|| ||  |  |      |  |           |  |^*****      | |        |  ||  ^*****||     | |     || ||^*****       | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                     |  |          ******               |  |     ..|| ||  |  |      |  |           |  |            | |        |  ||  ||| ||||     | |     ******            | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ****           ****|               ****     ..****|  ****      ****           ****            | |        |  |****|****||     | |      ****|            | |           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  nest ..                                      ***                        .. |  |            |  |                           | |        |  |    |  ****     | |        ***            ***           | | |                  |  | |              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                 .. ****            ****                           ***        ****    |   ***     ***                                     *****                  ******              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                 ..                                                                   ******                                                                                         

   New search    1oxd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML