triangle PDBeMotif: 1ow8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification transferase    | release date: Fri, Mar 28, 2003
Title paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Authors G.LABESSE, J.M.WERNER, M.E.M.NOBLE, M.K.HOELLERER, S.T.AROLD
Method X-RAY DIFFRACTION (resolution: 2.85Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET
IPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRP
H
Chains D,F sequence:
NLSELDRLLLELN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FOCAL ADHESION KINASE 1
sec str:  ........hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
seq num:  ..916       926       936       946       956       966       976       986       996       1006      1016      1026      1036          
search RasMol script viewer Motif-ligand binding stats  PS00001 ..   |  | |||^***    |   | ||  |                     |  | |  |   | ||                      | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |  | |||   |    |   ^**|  |                     |  | |  |   ^**|                      | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |  | |||   |    |      |  |                     ^*** |  |   ^***                      | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  PS00007 ..   ******^|   |    |      |  |                          |  |                             | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | | |   ^*****      |  |                          |  |                             | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      *****               |  |                          |  |                             | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      ***                 |  |                          |  |                             | || | |||                               | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          ****                          ****                             | || ****|                               | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |                          |  |                             | || | | |                               *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                          ****                             ****** | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                              *****                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ***                                     

chain B : FOCAL ADHESION KINASE 1
sec str:  .................hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..QEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG
seq num:  ..907       917       927       937       947       957       967       977       987       997       1007      1017      1027      1037       
search RasMol script viewer Motif-ligand binding stats  PS00001 ..       | || |  | |||^***|   |   | ||  |                     |  ||| ||   | || ||                   | || | |                                   
search RasMol script viewer Motif-ligand binding stats  PS00005 ..       | || |  | ||| | ||   |   ^**|  |                     |  ||| ||   ^**| ||                   | || | |                                   
search RasMol script viewer Motif-ligand binding stats  PS00006 ..       | || |  | ||| | ||   |   |  |  |                     ^***|| ||   ^*** ||                   | || | |                                   
search RasMol script viewer Motif-ligand binding stats  PS00007 ..       | || ******^| | ||   |   |  |  |                     |   || ||     |  ||                   | || | |                                   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..       | || |  | | | | ^*****   |  |  |                     |   || ||     |  ||                   | || | |                                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | || |  | | | |  |   |   |  |  |                     |   || ||     *****                   | || | |                                   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | || |  ***** |  |   |   |  |  |                     |   || ||     |  |                    | || | |                                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | || |  ***   |  |   |   |  |  |                     |   || ||     |  |                    | || | |                                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | || |  |     ****   |   |  |  |                     |   *****     ****                    | || | |                                   
search RasMol script viewer Motif-ligand binding stats  niche ..       **** ****            |   |  ****                     |   |****                             ****** |                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..       | |                  *****                           *****                                      | |                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..       ***                                                                                             ***                                   

chain C : FOCAL ADHESION KINASE 1
sec str:  ..................hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..PQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG
seq num:  ..906       916       926       936       946       956       966       976       986       996       1006      1016      1026      1036        
search RasMol script viewer Motif-ligand binding stats  PS00001 ..        | ||||| | |||^***    |  || ||   |  ||     |  ||  |  || || |  |   | ||               |  ||                                    |  ||  ||
search RasMol script viewer Motif-ligand binding stats  PS00005 ..        | ||||| | |||   |    |  |^**|   |  ||     |  ||  |  || || |  |   ^**|               |  ||                                    |  ||  ||
search RasMol script viewer Motif-ligand binding stats  PS00006 ..        | ||||| | |||   |    |  |  ||   |  ||     |  ||  |  |^*** |  |   ^***               |  ||                                    |  ||  ||
search RasMol script viewer Motif-ligand binding stats  PS00007 ..        | |||******^|   |    |  |  ||   |  ||     |  ||  |  |  || |  |                      |  ||                                    |  ||  ||
search RasMol script viewer Motif-ligand binding stats  PS00008 ..        | ||||| | | |   ^*****  |  ||   |  ||     |  ||  |  |  || |  |                      |  ||                                    |  ||  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | ||||| | | |           *****   *****     *****  |  ***** |  |                      *****                                    *********
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | ||||| *****           |  |    |  |      |  |   |  |  |  |  |                      |  |                                     |  ||  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | ||*** ***             |  |    |  |      |  |   |  |  |  |  |                      |  |                                     |  ||  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | || |  |               ****    ****      ****   *******  ****                      ****                                     ******** 
search RasMol script viewer Motif-ligand binding stats  niche ..        **** ****                                                 ****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..        ***                                                                                                                                   

chain D : PAXILLIN
sec str:  ..hhhhhhhhhhhh
sequence :  ..LSELDRLLLELN
seq num:  ..2           
search RasMol script viewer Motif-ligand binding stats  PS00001 ..*** | |  || 
search RasMol script viewer Motif-ligand binding stats  PS00006 .. ^*** |  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****  

chain F : PAXILLIN
sec str:  ..hhhhhhhhhhhh
sequence :  ..LSELDRLLLELN
seq num:  ..2           
search RasMol script viewer Motif-ligand binding stats  PS00001 ..*** |       
search RasMol script viewer Motif-ligand binding stats  PS00006 .. ^***       

   New search    1ow8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors