triangle PDBeMotif: 1ote  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Fri, Mar 21, 2003
Title e46q mutant of photoactive yellow protein, p65 at 110k
Authors K.MOFFAT, S.ANDERSON, S.CROSSON
Method X-RAY DIFFRACTION (resolution: 1.40Å)
PDBe Citation   
Small molecules:    search HC4 HC4 binding statistics HC4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOTOACTIVE YELLOW PROTEIN, PYP
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PFAM:searchPF00989PIRSF:searchPIRSF000087PROSITE PROFILES:searchPS50112, SMART:searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR02373UniProt:searchP16113
JMol viewer RasMol script viewer  HC4 169A  ..                           *          *   *   * *         *   ****                          * *                           
sec str:  ........hhhhhhh.....hhhhh..eeeeee....eeeehhhhhhhhh.hhhhhh........hhhhh...hhhhhhhhhhhh..eeeeeeee......eeeeeeeee.....eeeeeeee.
sequence :  ..VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  | |  |||  |  ||| ||       | ||| ||        ^**| |||| |       |  |          |  | |  |  |                    ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  | |  |||  |  ||| ||       | ||| ||        ^*** |||| |       |  |          |  | |  ^***                    ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  | |  |||  |  ^*****       | ||| ||        | || |||| |       |  |          ^*****                          ||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  | *****|  |   || ||       | ||| ||        | |*****| |       |  |             | |                          ||||        
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  | |  | |  |   || ||       | ||| **        | || |||| |       |  |             | |                          ||||        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |  | |  | |  |   || ||       *****           | || |||| |       |  |             | |                          ||||        
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  | **** |  |   ****|       ****|           | |****|| |       ****             | |                          ||||        
search RasMol script viewer Motif-ligand binding stats  nest .. |  |      |  |    |  |         ***           ***  | || |                        ***                          ****        
search RasMol script viewer Motif-ligand binding stats  niche .. ****      ****    ****                       | |  ******                        | |                          | |         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***                                ***                          ***         

   New search    1ote:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors