triangle PDBeMotif: 1oix  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein transport    | release date: Thu, Jun 26, 2003
Title x-ray structure of the small g protein rab11a in complex with gdp and pi
Authors B.GOUD, F.SENIC-MATUGLIA, J.CHERFILS, J.SALAMERO, L.RENAULT, S.PASQUALATO
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP   search PO4 PO4 binding statistics PO4   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MRGSHHHHHHGIPLPGRAMGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKA
QIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAF
AEKNGLSFIETSALDSTNVEAAFQTILTEIY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RAS-RELATED PROTEIN RAB-11A
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF313PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP62491
JMol viewer RasMol script viewer  CL 401A  ..                                                                  ***                                                                                                   
JMol viewer RasMol script viewer  MG 301A  ..                   *                 *                            |||                                                                                                   
JMol viewer RasMol script viewer  PO4 202A  ..              *   *|                **                        **  |||                                                                                                   
JMol viewer RasMol script viewer  GDP 201A  ..              |******         ***** ||                        ||  |||                                                 ** **                         ***                 
sec str:  ......eeeeeeeee....hhhhhhhhhhhh...........eeeeeeeeee..eeeeeeeeee.........hhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeeehhhhhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhh
sequence :  ..DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIY
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |   |   |  |||||||    || | | |     |    |    |  || |      | ||  |  | | ||||   |   |  |   |  |       |  ||  |      ^***|| ||             | ||  | | || || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |   |   |  |||||||    || | | |     |    |    |  |^**      | ||  |  | | ||||   |   |  |   |  |       |  ||  |       | ||| ||             | ||  | | || || |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*   |   |   |  |||||||    ^*** | |     |    |    |  |         | ||  |  | | ||||   |   |  |   |  |       |  ||  |       | ||| ||             | |^*** ^*** ^***           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..****^   |   |  |||||||     | | | |     |    |    |  |         | ||  |  | | ||||   |   |  |   |  |       |  ||  |       | ||| ||             | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |   |  ^*****|     | | | |     ^*****    |  |         | ||  |  | | ||^*****   |  |   |  |       |  ||  |       | ||| ||             | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..        |   ******** |     | | | |               |  |         | ||  |  | | || |       |  |   |  |       |  ||  |       | ||| ||             | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  SIGMA54_INTERACT_1 ..        **************     | | | |               |  |         | ||  |  | | || |       |  |   |  |       |  ||  |       | ||| ||             | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..               |||||       | | | |               |  |         | ||  |  | | || |       |  |   |  |       |  ||  |       | ||| ||             | |     | |***| |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..               |||||       | | | |               ****         | ||  |  | | ****       ****   ****       |  ||  |       *******|             | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  nest ..               *****       *** | |                            | ||  |  | | || |       |  |              |  ||  |       *** |  |             ***     | |******           
search RasMol script viewer Motif-ligand binding stats  niche ..                               ***                            *******  | ******       ****              ********           ****                     | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                       ***                                                                          ***                 

   New search    1oix:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors