triangle PDBeMotif: 1oaw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification neurotoxin    | release date: Wed, Jun 28, 1995
Title omega-agatoxin iva
Authors H.GOUDA, H.IWAI, I.SHIMADA, J.I.KIM, K.SATO, S.KONISHI, T.KOHNO, Y.ARATA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |    |    || ||   ||||^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |    ^*****| |^*****|||                
search RasMol script viewer Motif-ligand binding stats  nest ..    | |  |          ***    *****                
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                                      

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |       |    || ||   ||||^***        | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |       ^*****| |^*****|||           | |  
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***    *****           ***  
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                         

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |       |    || ||   ||||^***    | |   | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |       ^*****| |^*****||||      | |   | |
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***    ******      | |   ***
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                ***      

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ||||      |    || ||   ||||^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||||      ^*****| |^*****||||               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |***            | |    ||||||               
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***    ******               
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                         

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     | ||   |   |   ||||^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     | ^*****   ^*****||| |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     ****           ||||| |              
search RasMol script viewer Motif-ligand binding stats  nest ..    | |                    ***** |              
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                       ****              

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     | ||   || ||   ||||^***          | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     | ^*****| |^*****||| |           | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     ****    | |    ||||| |           | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |             | |    ||||| |           ***
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***    ***** |              
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                       ****              

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |  | ||   || ||   ||||^***     | || | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |  | ^*****| |^*****||  |      | || | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | ****  ****    | |    | ||  |      | || | |
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***    ***|  |      | |*****
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                       ****      ***     

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     | ||   || ||   ||||^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     | ^*****| |^*****||| |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     ****    | |    ||||| |              
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***    ***** |              
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                       ****              

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |       |    || ||    | |^***     | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |       ^*****| |^***** |  |      | |     
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***       |  |      ***     
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                       ****              

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |    |    |   |   ||||^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |    ^*****   ^*****||||               
search RasMol script viewer Motif-ligand binding stats  nest ..    | |  |                 ******               
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                                      

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |    |    || ||   ||||^***     | ||  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |    ^*****| |^*****||| |      | ||  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |  |          ***    ***** |      ***|  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                    ****         **** 

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |    |    || ||   ||||^***    | | | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |    ^*****| |^*****|||       | | | | |
search RasMol script viewer Motif-ligand binding stats  nest ..    | |  |          ***    *****       | | *****
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                             ***      

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |    |    || ||    |||^***         ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |    ^*****| |^*****||||           ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | ****          | |     |||||           ||||
search RasMol script viewer Motif-ligand binding stats  nest ..    | |             ***     *****           ****
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                         

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OMEGA-AGATOXIN IVA
member of: CATH:search4.10.40.10GENE3D:searchG3DSA_4.10.40.10PFAM:searchPF02819SUPERFAMILY:searchSSF57059UniProt:searchP30288
sec str:  ...........eee...........eeee......eeee...........
sequence :  ..KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
seq num:  ..1         11        21        31        41      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |  | ||   || ||    |||^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |  |  | ^*****| |^*****||| |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |  |  ****    | |     |||| |              
search RasMol script viewer Motif-ligand binding stats  nest ..    | |  |          ***     **** |              
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                    ****              

   New search    1oaw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML