triangle PDBeMotif: 1nkn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification contractile protein    | release date: Fri, Jan 3, 2003
Title visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod
Authors A.BLAZSEK, C.COHEN, J.H.BROWN, L.FARKAS, L.NYITRAY, L.RESHETNIKOVA, Y.LI
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
GSHMPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVA
RLKKLVGER
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : S2N51-GCN4
member of: CATH:search1.20.5.340GENE3D:searchG3DSA_1.20.5.1070/searchG3DSA_1.20.5.340/searchG3DSA_4.10.270.10PANTHER:searchPTHR11462/searchPTHR11462_SF35/searchPTHR13140/searchPTHR13140_SF358PFAM:searchPF00170PROSITE PATTERNS:searchPS00036, PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF52540/searchSSF57959/searchSSF90257UniProt:searchP03069/searchQ17042
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..MKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER
seq num:  ..846       856       866       876       886       896       906       916 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 | |    |   ^*** |       | | |                      | ||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 ^**    |     |  |       ^** |                      | ||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                        |     ^***           |                      | ||| 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..                        **********************                      | ||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                                    ****| 
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                      *** 

chain B : S2N51-GCN4
member of: CATH:search1.20.5.340GENE3D:searchG3DSA_1.20.5.1070/searchG3DSA_1.20.5.340/searchG3DSA_4.10.270.10PANTHER:searchPTHR11462/searchPTHR11462_SF35/searchPTHR13140/searchPTHR13140_SF358PFAM:searchPF00170PROSITE PATTERNS:searchPS00036, PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF52540/searchSSF57959/searchSSF90257UniProt:searchP03069/searchQ17042
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..EEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGE
seq num:  ..843       853       863       873       883       893       903       913   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  ||   |   | |    |   ^*** |       | | |                           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  ||   |   ^**    |     |  |       ^** |                           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  ||   |   |      |     ^***           |                           
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        |  ||   |   |      **********************                           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****   |   |                                                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****    |   |                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : S2N51-GCN4
member of: CATH:search1.20.5.340GENE3D:searchG3DSA_1.20.5.1070/searchG3DSA_1.20.5.340/searchG3DSA_4.10.270.10PANTHER:searchPTHR11462/searchPTHR11462_SF35/searchPTHR13140/searchPTHR13140_SF358PFAM:searchPF00170PROSITE PATTERNS:searchPS00036, PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF52540/searchSSF57959/searchSSF90257UniProt:searchP03069/searchQ17042
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER
seq num:  ..845       855       865       875       885       895       905       915  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |   | |    |   ^*** |   |  || | |                            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |   ^**    |     |  |   |  |^** |                            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |   |      |     ^***   |  ||   |                            
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..              |   |      **********************                            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |   |                   *****                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |   |                   ****                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                                        

chain D : S2N51-GCN4
member of: CATH:search1.20.5.340GENE3D:searchG3DSA_1.20.5.1070/searchG3DSA_1.20.5.340/searchG3DSA_4.10.270.10PANTHER:searchPTHR11462/searchPTHR11462_SF35/searchPTHR13140/searchPTHR13140_SF358PFAM:searchPF00170PROSITE PATTERNS:searchPS00036, PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF52540/searchSSF57959/searchSSF90257UniProt:searchP03069/searchQ17042
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGE
seq num:  ..843       853       863       873       883       893       903       913   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| || ||             | |    |   ^*** |   ||  ||| |                    |  || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || ||             ^**    |     |  |   ||  ^** |                    |  || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| || ||                    |     ^***   ||  ||  |                    |  || |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..| || ||                    **********************                    |  || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| *****                                 |*****                       ***** |
search RasMol script viewer Motif-ligand binding stats  betaturn ..******                                  |****                        ****| |
search RasMol script viewer Motif-ligand binding stats  nest ..                                        |   |                            ***
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        *****                               

   New search    1nkn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors