triangle PDBeMotif: 1nhx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   4.1.1.32
Classification lyase    | release date: Thu, Dec 19, 2002
Title pepck complex with a gtp-competitive inhibitor
Authors G.RAMSEY, L.H.FOLEY, M.-L.GUBLER, P.DUNTEN, P.WANG, S.J.WERTHEIMER
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search FTB FTB binding statistics FTB   search MN MN binding statistics MN   search NA NA binding statistics NA   search PEP PEP binding statistics PEP   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GELMPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWL
ALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIG
IELTDSPYVVASMRIMTRMGTPVLEALGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGG
NSLLGKKCFALRMASRLAKEEGWLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKF
DAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGE
PCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMH
DPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGY
IPKEDALNLKGLGHINMMELFSISKEFWDKEVEDIEKYLVDQVNADLPCEIEREILALKQRISQM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
member of: CATH:search2.170.8.10/search3.40.449.10/search3.90.228.20GENE3D:searchG3DSA_3.40.449.10/searchG3DSA_3.90.228.20HAMAP:searchMF_00452PANTHER:searchPTHR11561/searchPTHR11561_SF1PFAM:searchPF00821PIRSF:searchPIRSF001348PROSITE PATTERNS:searchPS00505, SUPERFAMILY:searchSSF53795/searchSSF68923UniProt:searchP35558
JMol viewer RasMol script viewer  EDO 706A  ..                                                              *                                                                                                                                                                                                                                                                                      **               *    *                                                                                           ..EDO ..                                                                                                                                                      
JMol viewer RasMol script viewer  EDO 705A  ..                                                              |                                                                                                                                                                                                                                                                                      ||               |    |                                                                           **              ..EDO ..                                    ***                                                                                                               
JMol viewer RasMol script viewer  FTB 704A  ..                                                              |                                                                                                                                                                                                                      * *  **  *                                              *       ||               |    |                                                                           ||              ..FTB ..                                    |||    **       *  * *  *                                                                                         
JMol viewer RasMol script viewer  PEP 703A  ..                                                              |             **                                                                                                                                                   ***      *                                          | |  ||  |                                              |       ||               |    |                             * *                                           ||              ..PEP ..            *                       |||    ||       |  | |  |                                                                                         
JMol viewer RasMol script viewer  NA 702A  ..                                                              |             ||                                                                                                                                                   |||      |                                          | |  ||  |                                              |       ||               |    |                             | |                                           ||              ..NA ..            |                       |||    ||       |  | |  |                                                                                         
JMol viewer RasMol script viewer  MN 701A  ..                                                              |             ||                                                                                                                                                   |||      *                   *                      | |  ||  |              *                               |       ||               |    |                             | |                                           ||              ..MN ..            |                       |||    ||       |  | |  |                                                                                         
sec str:  ...hhh.eee......hhhhhhhhhhhhhhhh..eeee...hhhhhhhhhhhhhhh..eeee.....eeee.........hhh.eeee..hhhhhh............eehhhhhhhhhhh.........eeeeeeeee........eeeeeee.hhhhhhhhhhhheehhhhhhhhh....eeeeee.................hhhhheeeeehhh.eeeee...hhhhhh.......hhhhhhhhhhhh.eee..eeeeee.....eeeeeee.....hhhhhhh........eeeeee...eeeee.....eeee....eeeee........hhhhhhhh....eee..eee....ee.............ee.....eehhhhh........eeeee.hhh............eeeeeeeee.........eee..hhhhhhhhhhh.eee.... ....eee.hhhh......hhhhhhhhhhhhhhh......eeeee..............hhhhhhhhhhhhhhhhh....eeee..eeee.............hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..NLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEALGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEA... ..KIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWDKEVEDIEKYLVDQVNADLPCEIEREILALKQRISQM
seq num:  ..10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460  ... ..473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***||  |||| |                       | |  ||         ||||  |  |  |     | |||   |  |   | | |  |       | |    |  ||      | || || |          | || ||| |   |||     |||  |         || |       ||||               |  |    || |||  | || | |   |  |             | |   |      || | |       |  |||||||  | | |  |              | |||    | |    | | ||| ||| | | | || | |  |    | |    ||||  | ||   | | |  |  | |   |  ||    |  |  || |  |       |   || ||  |           |   || |    ..PS00001..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||| | |      | |||| |      |  | |   | |       |    || ||                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |^**|  |||| |                       | |  ||         ||||  |  |  |     | |||   |  |   | | |  |       | |    |  ||      | || || |          | || ||| |   |||     ^**  |         || |       ||||               |  |    || |||  | || | |   |  |             | |   |      || | |       |  |||||||  | | |  |              | |||    | |    | | ||^**|| | | | || | |  |    | |    ||||  | ||   ^** |  |  | |   |  ||    |  |  || |  |       |   || ||  |           |   || |    ..PS00005..     || ||| ||             |  |  |        | || | |||       |  |      || ||||^** | |      | |||| |      |  | |   | |       |    || ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |||||  |||| |                       | ^***|         ||||  |  |  |     | |||   |  |   | | |  |       | |    ^***|      | || || |          | || ||| |   |||      ||  |         || |       ||||               |  |    || |||  | || | |   |  |             | |   |      ^*** |       |  |||||||  | | |  |              | |||    | |    | | ||   || | | | || | |  |    | |    ||||  | ||   | | |  ^*** |   |  ||    |  |  || |  |       |   || ||  |           |   || |    ..PS00006..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||  | |      | |||| |      |  | |   | |       |    || ||                  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |||||  |||| |                       | |   |         ||||  |  |  |     | |||   |  |   | | |  |       | |    |   |      | || || |          | || ||| |   |||      ||  |         || |       ||||               |  |    || |||  | || | |   |  |             | |   |       | | |       |  |||||||  | | |  |              | |||    | |    | | ||   || | | | || | |  |    | |    ||||  | ||   | | |     | |   |  ||    |  |  || |  |       |   || ||  |           |   || |    ..PS00007..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||  | |      | |||| |      |  | |   | ********^    || ||                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****||  ^*****                       | |   |         ||||  |  |  |     | |||   |  |   | | |  |       | |    |   |      | |^*****          | ^***** ^*****|      ||  |         || |       ||||               |  |    || |||  | ^*****   |  |             | |   |       | | |       |  |||||||  | | |  |              | |||    | |    ^*****   || | | | || | |  |    | |    ||||  | ^***** | |     | |   |  ||    |  |  || |  |       ^***** ||  |           ^***** |    ..PS00008..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||  | |      | |||| |      |  | |   |              || ||                  
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. || ||   ||| |                       | |   |         ||||  |  |  |     | |||   |  |   | | |  |       | |    |   |      | || || |          |  | ||      | |      ||  |         || |       ||||               |  |    || |||  |  | |     ^***             | |   |       | | |       |  |||||||  | | |  |              | |||    | |      | ||   || | | | || | |  |    | |    ||||  |  |   | | |     | |   |  ||    |  |  || |  |           ^***|  |               |  |    ..PS00009..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||  | |      | |||| |      |  | |   |              || ||                  
search RasMol script viewer Motif-ligand binding stats  PEPCK_GTP .. || ||   ||| |                       | |   |         ||||  |  |  |     | |||   |  |   | | |  |       | |    |   |      | || || |          |  | ||      | |      ||  |         || |       ||||               |  |    || |||  |  | |                      | |   |       | | |       ****^****|  | | |  |              | |||    | |      | ||   || | | | || | |  |    | |    ||||  |  |   | | |     | |   |  ||    |  |  || |  |               |  |               |  |    ..PS00505..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||  | |      | |||| |      |  | |   |              || ||                  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. || ||   ||| |                       | |   |         ||||  |  |  |     *****   |  |   | | |  |       | |    |   |      | || || |          |  | ||      | |      ||  |         || |       ||||               |  |    || |||  |  | |                      | |   |       | | |          ||||| |  | | |  |              | |||    | |      | ||   |***** | || | |  |    | |    ||||  |  |   | | |     | |   |  ||    |  |  || |  |               |  |               |  |    ..asxmotif..     || ||| ||             |  |  |        | || | |||       |  |      || ||||||  | |      | |||| |      |  | |   |              || ||                  
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||   ||| |                       | |   |         ||||  |  |  |     ***|    |  |   | | |  |       | |    |   |      | || || |          |  | ||      | |      ||  |         || |       ||||               |  |    || |||  |  | |                      | |   |       *** |          ||||| |  | | |  |              | |||    | |      | ||   |  |   | || | |  |    | |    ||||  |  |   | | |     | |   |  ||    |  |  |***  |               |  |               |  |    ..asxturn..     || ||| ||             |  |  |        ***| | |||       |  |      || ||||||  | |      | |*** |      |  | |   |              || ||                  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. || ||   ||| |                       | |   |         ||||  |  |  |     |  |    |  |   | | |  |       | |    |   |      | || || |          |  | ||      | |      ||  |         || |       ||||               |  |    ******  |  | |                      | |   |         | |          ||||| |  | | |  |              *****    | |      | ||   |  |   | || | |  |    | |    ||||  |  |   | | |     | |   |  ||    |  |  |  |  |               |  |               |  |    ..betabulgeloop..     || ||| ||             |  |  |        |  | *****       |  |      || ||||||  | |      | |||| |      |  | |   |              || ||                  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|   ||| |                       | |   |         ||||  ****  |     ****    ****   | | |  |       | |    |   |      | || ****          |  | ||      | |      ||  |         ****       ||||               |  |     ****|  |  | |                      | |   |         | |          ||||| |  | | |  |              ****|    | |      ****   |  |   | || | |  |    | |    ||||  |  |   | | |     | |   ****|    *******  |  |               |  |               |  |    ..betaturn..     ********|             |  ****        |  | ****|       ****      |****||||  | |      | ||****      |  | |   |              ****|                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |   ||| |                       | |   |         ||||  |  |  |             |  |   | | |  |       | |    |   |      | || || |          |  | ||      | |      ||  |          | |       ||||               |  |       | |  |  | |                      | |   |         | |          ||||| |  | | |  |                | |    | |      | ||   |  |   | || | |  |    | |    ||||  |  |   | | |     | |   |  ||    |  |  |  |  |               |  |               |  |    ..gammaturn..        | |  |             |  |  |        |  |   | |                 |  | ***|  | |      | |||| |      |  | |   |               |  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |   ||| |                       ***   |         ****  |  |  |             |  |   | | |  |       | |    |   |      | |***| |          |  | ||      | |      ||  |          | |       |***               |  |       ***  |  | |                      ***   |         ***          ***** |  | | |  |                ***    | |      | ||   |  |   | || | |  |    ***    ****  |  |   | ***     ***   |  ||    |  |  |  |  |               |  |               |  |    ..nest..        ***  |             |  |  |        |  |   ***                 |  ***| |  | |      ***||| |      |  | |   |               |  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****   |****                         |   |               *******             ****   *** ****       | |    |   |      *********          *******      | |      |****          ***       | |                ****            ******                            |                            **** ******                       ***      ****   |  |   ****** ****                 ****   | |             ****|    *******  ****               ****               ****    ..niche..          ****             *******        ****                       |    |***  | |      ********      **** |   |               ****                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         | |                           |   |                                                         | |    |   |                            | |       | |      |   |                    | |                                   | |                            |                                                                         |    |  |   |                                  | |                 |                                                           ..schellmannloop..                                                                     ******     | |                         |   |                                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..         | |                           *****                                                         | |    *****                            | |       | |      |   |                    | |                                   | |                            |                                                                         |    |  |   |                                  | |                 |                                                           ..stmotif..                                                                                | |                         *****                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..         | |                                                                                         | |                                     | |       | |      *****                    | |                                   | |                            |                                                                         ******  *****                                  | |                 |                                                           ..ststaple..                                                                                | |                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..         ***                                                                                         ***                                     ***       ***                               ***                                   ***                            |                                                                                                                        ***                 |                                                           ..stturn..                                                                                ***                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                              *                                                                                                                                            *                                                           ..REP00000..                                                                                                                                                      

   New search    1nhx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML