triangle PDBeMotif: 1nh3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   5.99.1.2
Classification isomerase/dna    | release date: Wed, Dec 18, 2002
Title human topoisomerase i ara-c complex
Authors A.B.BURGIN, J.E.CHRENCIK, L.STEWART, M.R.REDINBO, Y.POMMIER
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Modified residues:  search CAR CAR binding statistics CAR search UBB UBB binding statistics UBB search GNG GNG binding statistics GNG search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDW
RKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFR
GRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQ
KYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE
YVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQL
KELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKK
VVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADED
YEF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA TOPOISOMERASE I
member of: CATH:search1.10.10.41/search1.10.132.10/search2.170.11.10/search3.90.15.10GENE3D:searchG3DSA_1.10.10.41/searchG3DSA_1.10.132.10/searchG3DSA_2.170.11.10/searchG3DSA_3.90.15.10PANTHER:searchPTHR10290/searchPTHR10290_SF1PFAM:searchPF01028/searchPF02919/searchPF14370PRINTS:searchEUTPISMRASEIPROSITE PATTERNS:searchPS00176, SMART:searchSM00435SUPERFAMILY:searchSSF46596/searchSSF56349/searchSSF56741UniProt:searchP11387
sec str:  ....................ee..................ee..ee.....hhhhhhhhhhh........hhhhhhhhhhh.......hhhhhh.hhh.eehhhhhhhhhhhhhh......hhhhhh....hhhhhhh.eee.....ee.................................eee.................eee........eeee......eeee.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh......................hhh.eeeeeee..eeeeeeeeee.....eeeeeee.hhhhhhhhhhhhh............hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.........hhhhhhhhh...... ........hhhhhhhhhhhh..hhhhh...hhhhhhhhhhh........
sequence :  ..WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAV... ..SKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
seq num:  ..203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623 ... ..719       729       739       749       759    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||  |  |                       |  |           | | |       | |   || ||              |  ||  | ^***||       |   |  |  ||  |             |  |           | |    |    |  | || |      |  |  ^*** |                |  | |  |  |  | | |    | ||| |     | | | |     |  ||                          | ||       | |     | ||||  |                     | |              |  | |  |  |      | |         |  || |  || ^***|     |  || ||   |   |     | |..PS00001.. |  | | ||       | |      ^***||         |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||  |  |                       |  |           ^** |       | |   |^**|              |  ||  |  || ||       |   |  |  ||  |             |  |           | |    |    |  | || |      |  |    |  |                |  | |  |  |  | ^**    | ^** |     | | ^**     |  ||                          | ||       | |     | ^**|  |                     ^**              |  | |  |  |      | |         |  |^**  || | | |     |  || ||   |   |     | |..PS00005..**  | | ||       | |      | ^**|         |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||  |  |                       |  |           |   |       | |   |^***              ^***|  |  |^***       |   |  |  |^***             |  |           | |    |    |  | || |      |  |    |  |                |  | |  ^***  | |      |  |  |     | | |       |  ||                          | ||       | |     |  | |  |                                      |  | |  |  |      | |         |  |     || | | |     |  ^***|   |   |     | |..PS00006..    | | ||       | |      | ^***         |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. *******^                       |  |           |   |       ******^| |                   |  |  |  |        |   |  |  |                 |  |           | |    |    |  | || |      |  |    |  |                |  | |        | |      |  |  ********^ |       |  ||                          | ||       | |     |  | |  |                                      |  | |  |  |      | |         |  |     || | | |     |  ||  |   |   |     | |..PS00007..    | | ||       | |      | |            |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |    ^*****  | || |      |  |    |  |                |  | |        | |      |  |        |   |       |  ||                          | ||       | |     |  | |  |                                      |  | |  |  |      | |         |  |     || | | |     |  ||  |   |   |     | |..PS00008..    | | ||       | |      | |            |  |  
search RasMol script viewer Motif-ligand binding stats  TOPOISOMERASE_I_EUK ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |            | || |      |  |    |  |                |  | |        | |      |  |        |   |       |  ||                          | ||       | |     |  | |  |                                      |  | |  |  |      | |         |  |     || | | |     |  ||  |   |   |     | |..PS00176..****^*****       | |      | |            |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |            | || |      |  |    |  |                |  | |        | |      |  |        |   |       *****                          | ||       | |     |  | |  |                                      |  | |  |  |      | |         |  |     || | | |     |  ||  |   |   |     | |..alphabetamotif..      | |        | |      | |            |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |            | || |      |  |    |  |                |  | |        | |      |  |        |   |       |  |                           | ||       | |     |  | |  |                                      |  | |  |  |      ***         |  |     || | | |     |  ||  |   |   |     | |..asxturn..      ***        | |      ***            |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |            | || |      |  |    |  |                |  | |        | |      |  |        |   |       ****                           | ||       | |     |  | |  |                                      **** |  |  |                  |  |     || | | |     |  ||  |   |   |     | |..betaturn..                 | |                     |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |            | || |      |  |    |  |                |  | |        | |      |  |        |   |                                      | ||       | |     |  | |  |                                         | |  |  |                  |  |     || | | |     |  ||  |   |   |     ***..gammaturn..                 | |                     |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                          |  |           |   |         |   || |                   |  |  |  |        |   |  |  |                 |  |           | |            | || |      |  |    |  |                |  | |        ***      |  |        |   |                                      ***|       ***     |  | |  |                                         | |  |  |                  |  |     || | | |     |  ||  |   |   |        ..nest..                 ***                     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                          ****           |   |         |   ****                   ****  ****        |   |  ****                 ****           ***            ******      ****    ****                ******                 ****        |   |                                         |               **** ****                                         ***  ****                  ****     || | | |     ********   |   |        ..niche..                                         ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               *****         |    |                                       |   |                                                                                                                                |   |                                         |                                                                                                     || | | |                |   |        ..stmotif..                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                             ******                                       *****                                                                                                                                *****                                         |                                                                                                     |*******                *****        ..ststaple..                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                             *                                                                                                     *                                    ..REP00000..                                               

chain B : 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*UP*(UBB))-3'
sec str:  ............
sequence :  ..AAAAAGACUU
seq num:  ..1         

chain C : 5'-D(*(GNG)P*GP*AP*AP*AP*AP*AP*UP*UP*UP*UP*T)-3'
sec str:  ..............
sequence :  ..GGAAAAAUUUUT
seq num:  ..11          

chain D : 5'-D(*AP*AP*AP*AP*AP*TP*UP*UP*UP*UP*CP*(CAR)P*AP*AP*GP*UP*CP*UP*UP*UP*UP*T)-3';
sec str:  ........................
sequence :  ..AAAAATUUUUCCAAGUCUUUUT
seq num:  ..101       111         

   New search    1nh3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors