triangle PDBeMotif: 1n35  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transferase/rna    | release date: Fri, Oct 25, 2002
Title lambda3 elongation complex with four phosphodiester bond formed
Authors D.L.FARSETTA, M.L.NIBERT, S.C.HARRISON, Y.TAO
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search U U binding statistics U   search CH1 CH1 binding statistics CH1   search MN MN binding statistics MN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MINOR CORE PROTEIN LAMBDA 3
member of: PFAM:searchPF07925PROSITE PROFILES:searchPS50523, SUPERFAMILY:searchSSF56672UniProt:searchP0CK31
JMol viewer RasMol script viewer  CH1 1295A  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            *                                     ****                                                                                                                                                                                   *                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  CH1 1294A  ..                              *  **                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         |                                    *||||      *                                                                                                                                                                            |                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  CH1 1291A  ..                              |  ||                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ** *                                                            *  *                                                                                           *                                                   *                                                                               |                                    |||||      |                                                                                                                                                                            |                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  MN 1302A  ..                              |  ||                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      || |                                                            |  |                                                                                           |                                                   |                                                                               |                                    |||||      |                                                                                                                                                                            |                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  MN 1301A  ..                              |  ||                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      || |                                                            |  |                                                                                           |                                                   |                                                                               |                                    |||||      |                                                                                                                                                                            |                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  U 1283C  ..                              |  ||                                                                                                                                                                                                                                                                                                                                                                                                                                           *                                                 **       || |                                                            |  |                                                                                           |                                                   |                                                                               |                                    |||||      |                                                                                                                                                                            |                                                                                                                                                                                                                                      
sec str:  ..hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhh...hhhh.eee.....eee...............hhh.eee......eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....ee....ee....hhhhhhhhhhhhhhhhhhhh.......ee......eee.......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.....eeeeeeeee..hhhhh.eeeeeeee.hhhhh.....hhhhhhhhhhhh.hhhhhhhhhhhhhhh.eehhhhhhhhhhhhh.........hhhhhhhhhh..........hhh.eeeee..eeee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh................hhhhhhhhhh..hhhhhhhhhhh.ee.eee.......eee...hhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhh...eeeeeeeehhhhhh....hhhhhhhhhhhhhhhhhh.........eeeee.......eeeeehhhhhhhhhhhhhhhhheeeeee.......eeeeee........hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh......eeee..eeeeee........hhhhhhhhhhhhhhhhhh...eee.....eeee..eeee..ee..hhhhh................hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..eeee......eeee.hhhhhhhhh...................hhhhhhhhhhhhhhhhhhhhhhh...eeeeee...eeehhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.....hhhhhhhh.eeeeeeee..................hhhhhhhhhhhh....hhhhhhhh...........hhhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhh..hhhhhhhhhee..................hhhhhhhhhhhhhhhhh....eeeeeeee.hhhhhhhhhhhhhhhhh..
sequence :  ..SSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNRVRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLVAEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQQTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKYARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIPQKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDFKGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSGSAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARPISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLMKSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPIVGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKAFGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGRAASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMRARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..               ||||             |  ||| ||   |  |   |  |     |  || | |  || | ||| | ||    | |   ^***|| |     |  |   | |      | |              |  |                    |  |  | |     || ||   |         || | | |           | | |||              |   ||||   |  ||    |    | |   |   |   | | || |||||              | |||         |||||| | | |         ||||     || || ||   |  |||     |  || |    |  ||               || ||          |  | | |             |  ||| || |  ||  |  || || | ||    || |^*** ||| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  | | ||| ^***    |||| ||              ||||| ||   | ||   |       |    |  |   | |   |       | | ^***| ||   | | | |||| ||| | ||^***  |      |  || | |    |  |         | |      |    |                   | |      | |        |  |   ^*** |  |    ^***|           |    |  | |            |  ||     | |           || |||          | ||  |                        | | | |     | |   |    ||||    |  |    ||| |                    | |      |  |  ||| || |  | | |||      | |  |  |  ||         || ||          |  |            | ||  |  ||  |    |   |      | | ||| ||     |||||  ||    |   || ||| |||     |||  || |     |  |  |   | | |||     |  |          | |      |  |                 | |  |           | ||   |       |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..               ||||             |  ||| ||   |  |   |  |     |  || | |  || | ||| **^*    | |     | || |     |  |   | |      | |              |  |                    |  |  | |     || ||   |         || | | |           | | |||              |   ||||   |  ||    |    | |   |   |   | | || |||||              | |||         |||||| | | |         ||||     |**^* ||   |  |||     |  || |    |  ||               || ||          |  | | |             |  ||| || |  ||  |  || || | ||    || ||||  ||| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  | | ||| |       |||| ||              ||||| ||   | ||   |       |    |  |   | |   |       | |  | || ||   | | | |||| ||| | ||  ||  |      |  || | |    |  |         | |      |    |                   | |      | |        |  |   | |  |  |    ||| |           |    |  | |            |  ||     | |           || |||          | ||  |                        | | | |     | |   |    ||||    |  |    ||| |                    | |      |  |  ||| || |  | | |||      | |  |  |  ||         |**^*          |  |            | ||  |  ||  |    |   |      | | ||| ||     |||||  ||    |   || ||| |||     |||  || |     |  |  |   | | |||     |  |          | |      |  |                 | |  |           | ||   |       |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               ||||             |  ||| ||   |  |   |  |     |  || | |  || | |||         | |     | || |     |  |   | |      | |              |  |                    |  |  | |     || ||   |         || | | |           | ^**||              |   ||||   |  ||    |    | |   |   |   | | || |||||              | |||         ^**||| | | |         ||||     |  || ||   |  ^**     |  || |    |  ||               || ||          |  | | |             |  ||| || |  ||  |  |^**| | ||    || ||||  ||| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  | | ||| |       |||| ||              ||||| ||   | ||   |       |    |  |   | |   |       ^**  | || ||   | | | |||| ||| | ||  ||  |      |  || | |    |  |         | |      |    |                   | |      | |        |  |   | |  |  |    ||| |           |    |  | |            |  ||     | |           || |||          | ||  |                        | | ^**     | |   |    ||||    |  |    ||^**                    | |      |  |  ||| || |  | | |||      | |  |  |  ||         |  |           |  |            | ||  |  ||  |    |   |      ^** ||| ||     |||||  ||    |   || ||| |||     |||  || |     |  |  |   | | |||     |  |          | |      |  |                 | |  |           | ||   |       |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               ||||             |  |^***|   |  |   |  |     |  || | |  || | |||         | |     ^*** |     |  |   | |      | |              |  |                    ^***  | |     || ||   |         || | | |           | | |||              |   ||||   |  ||    |    | |   |   |   | | || ^***|              | |||         |||||| | | |         ||||     |  || ||   |   |      |  || |    ^***|               || ||          |  | | |             |  ||| || |  ||  |  || || | ||    || |||^***|| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  | | ||| |       ^*** ||              ||||| ||   | ||   |       |    |  |   | |   |            | || ||   | | | |||| |^*** ||  |^***      |  || | |    |  |         | |      |    |                   | |      | |        |  |   | |  |  |    |^***           |    |  | |            |  ||     | |           || |||          | ||  |                        | | | |     | |   |    ||||    |  |    ||| |                    | |      |  ^***|| || |  | ^***|      | |  |  ^***|         |  |           |  |            | ||  |  ||  |    |   |      |   ||| ||     |^***  ||    |   || ||| |||     |||  ^***     |  |  |   | | |||     |  |          | |      |  |                 | |  |           | ||   |       |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..               ||||             |  ||| ||   |  |   |  |     |  |********^ | |||         | |       |  |     |  |   | |      | |              |  |                          | |     || ||   |         || | | |           | | |||              |   ||||   |  ||    |    | |   |   |   | | || ||| |              | |||         |||||| | | |         ||||     |  || ||   |   |      |  || |    |   |               || ||          |  | | |             |  ||| || |  ||  |  || || | ||    || |||   ||| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  | | ||| |        ||| ||              ||||| ||   | ||   |       |    |  |   | |   |            | || ||   | | | |||| |||   ||  ||         |  || | |    |  |         | |      |    |                   | |      | |        |  |   | |  |  |    | |             |    |  | |            |  ||     | |           || |||          | ||  |                        | | | |     | |   ********^    |  |    ||| |                    | |      ********^ || |  | | |||      | |  |  |   |         |  |           |  |            | ||  |  ||  |    |   |      |   ||| ||     | |||  ||    |   || ||| |||     |||   |       |  |  |   | | |||     |  |          | |      |  |                 | |  |           | ||   |       |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               ||||             |  ||| ||   |  |   |  |     |  |  | |  |  | |||         | |       |  |     |  |   | |      | |              |  |                          | |     || ||   |         || | | |           | | |||              |   ||^*****  |^*****    | |   |   |   | | || ||| |              | |||         |||||| | | |         ||||     |  || ||   |   |      |  || |    |   |               || ||          |  | | |             |  ||| || |  ||  |  || |^*****    || |||   ||| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  ^*****| |        ||| ||              |^*****|   | ^*****       ^*****  |   | |   |            | || ^***** | | ||^*****   ||  ||         |  || | |    |  |         | |      ^*****                   | |      | |        |  |   | |  |  |    | |             ^*****  | |            |  ||     | |           || |||          | ||  |                        | | | |     | |        ||||    |  |    ||| |                    | |             |  || |  | | |||      ^*****  |   |         |  |           |  |            | ||  |  ||  |    |   |      |   ||| ||     | ^*****|    |   || ||| |||     |^*****       |  |  |   | | |||     |  |          | |      |  |                 ^*****           | ^*****       |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               ||||             |  |*****   |  |   |  |     |  |  | |  |  | |||         | |       |  |     |  |   | |      | |              |  |                          | |     || ||   |         || | | |           | | |||              |   || |   *****         | |   |   |   | | || ||| |              | |||         |||||| | | |         ||||     |  || ||   |   |      |  || |    |   |               || ||          |  | | |             |  ||| || *****  |  || |  | |     || |||   ||| | |   |   |   |  ||| | ||| ||        |  |        |  ||  | |   |                | ||| |  | | ||| |        |*****              | ||| ||   |  |                   |   | |   |            | ||  |     | | || | |||   ||  ||         |  || | |    |  |         | |                               | |      | |        |  |   | |  |  |    | |                     | |            *****     | |           || |||          | ||  |                        | | | |     | |        ||||    |  |    ||| |                    | |             |  || |  | | |||        |  |  |   |         |  |           |  |            | ||  |  ||  |    |   |      |   ||| ||     |  |*****    |   || ||*****     | |           |  |  |   | | |||     |  |          | |      |  |                   |  |           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..               ||||             |  ||| ||   |  |   |  |     |  |  | |  |  | |||         | |       |  |     |  |   | |      | |              |  |                          | |     || |*****         || | | |           | | |||              |   || |   |  |          | |   |   |   | | || ||| |              | |||         |||||| | | |         ||||     |  || ||   *****      |  || |    |   |               || ||          |  | | |             |  ||| || |  |   |  || |  | |     || |||   ||| | |   |   |   |  ||| | ||| ||        |  |        *****  | |   |                | ||| |  | | ||| |        ||| |               | ||| ||   |  |                   |   | |   |            | ||  |     | | || | |||   ||  ||         |  || | |    |  |         | |                               | |      | |        |  |   | |  |  |    | |                     | |            |  |      | |           || |||          | ||  |                        | | | |     | |        ||||    |  |    ||| |                    | |             |  || |  | | |||        |  |  |   |         |  |           |  |            | ||  |  ||  |    |   |      |   ||| ||     |  ||  |     |   || ||| ||      | |           |  |  ***** | |||     |  |          | |      |  |                   |  |           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..               ||||             |  ||| ||   |  |   |  |     |  |  | |  |  | |||         | |       |  |     |  |   | |      | |              |  |                          | |     || ||             || | | |           | | |||              |   || |   |  |          | |   |   |   | | || ||| |              | |||         |||||| | | |         ||||     |  || ||              |  || |    |   |               || ||          |  | | |             |  ||| |***  |   |  || |  | |     || |||   ||| | |   |   |   |  ||| | ||| ||        |  |           |   | |   |                | ||| |  | | ||| |        ||| |               | ||| ||   |  |                   |   | |   |            ***|  |     | | || | |||   ||  ||         |  || ***    |  |         | |                               | |      ***        |  |   ***  |  |    | |                     | |            |  |      | |           || |||          | ||  |                        | | | |     | |        ||||    |  |    ||| |                    ***             |  || |  | | |||        |  |  |   |         |  |           |  |            ***|  |  ||  |    |   |      |   ||| ||     |  ||  |     |   || ||| ||      | |           |  |        | |||     |  |          | |      |  |                   |  |           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..               ||||             |  ||| ||   |  |   |  |     |  |  | |  |  *****         | |       |  |     |  |   | |      | |              |  |                          | |     || ||             || | | |           | | |||              |   || |   |  |          | |   |   |   | | || ||| |              | |||         |||||| | | |         ||||     |  || ||              |  || |    |   |               || ||          |  | | |             |  ||| || |  |   |  || |  | |     || |||   ||| | |   |   |   |  ||| | ||| ||        |  |           |   | |   |                | ||| |  | | ||| |        ||| |               | ||| ||   |  |                   |   | |   |            |  |  |     | | || | |||   ||  ||         |  || |      |  |         | |                               | |                 |  |        |  |    | |                     | |            |  |      | |           || |||          | ||  |                        | | | |     | |        ||||    |  |    ||| |                                    |  || |  | | |||        |  |  |   |         |  |           |  |            |  |  |  ||  |    |   |      |   ||| ||     |  ||  |     |   || ||| ||      | |           |  |        | |||     |  |          | |      |  |                   |  |           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..               ||||             |  |*****   |  |   |  |     |  |  | |  |  ****|         | |       |  |     ****   | |      | |              ****                          | |     *****             **** | |           | ****|              |   || |   ****          | |   |   |   | | ****|| |              ****|         *****| | | |         ||||     |  ****|              |  || |    |   |               ****|          |  | | |             |  |***** ****   |  || |  | |     *****|   |**** |   |   |   |  |**** |*****        |  |           |   | |   |                ****| |  | | ||| |        |****               ****| ||   ****                   |   | |   |            |  ****     | | || | |||   ||  ||         ****| |      ****         | |                               | |                 ****        |  |    | |                     | |            ****      | |           |****|          | ||  |                        | | | |     | |        ||||    |  |    |****                                    |  || |  | ****|        |  |  |   |         |  |           |  |            |  |  ********    |   |      |   |****|     ********     |   || |*****      | |           |  |        ****|     ****          | |      |  |                   |  |           ****           |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               ||||             |  ||   |   |  |   |  |     |  |  | |  |    | |         ***       |  |     |  |   | |      | |                                            | |      |  |              | | | |           *** |||              |   || |                 | |   |   |   | | || ||| |                | |         ||| || | | |         ||||     |   |  |              |  || |    |   |                |  |          |  | | |             |  | |  |        |  || |  | |        | |   ||| | |   |   |   |  | |   | |  |        |  |           |   | |   |                  | | |  | | ||| |        | | |                 | | ||                          |   | |   |            |  |        | | || | |||   ||  ||             | |      |  |         | |                               | |                             |  |    | |                     | |                      | |           |  | |          | ||  |                        | | | |     | |        ||||    |  |    ||| |                                    |  || |  | | | |        |  |  |   |         |  |           |  |            |  |              |   |      |   | |  |     |  |         |   || |           | |           |  |          | |     |  |          | |      |  |                   |  |                          |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..               ****             |  ||   |   |  |   |  |     |  |  | |  |    ***                   |  |     |  |   | |      ***                                            ***      |  |              | | | |             | |||              |   |***                 | |   |   |   | | || ||***                ***         ||| || | | |         ****     |   |  |              |  || |    |   |                |  |          |  | | |             |  | |  |        |  || |  ***        ***   *** | |   |   |   |  | |   | |  |        |  |           |   | |   |                  *****  | | ||| |        *** |                 | | ||                          |   | |   |            |  |        | | || | |||   ||  ||             | |      |  |         | |                               ***                             |  |    | |                     ***                      ***           |  ***          ***|  |                        *** | |     | |        ****    |  |    ||| |                                    |  |***  | | | |        |  |  |   |         |  |           |  |            |  |              |   |      |   | |  |     |  |         |   |***           ***           |  |          ***     |  |          | |      |  |                   |  |                          |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                ****|   |   ****   ****     ****  | ****                          ****     ****   | |                                                              ****              *******             ****|              |   |                    | |   |   |   | | |****                               |******* | |                  |   ****              *******    |   |                ****          ****** |             **** ****        *******                    ******   |   |   **** |   | ****        ****           |   | |   |                         | *******        |   |                 | ****                          |   | |   |            ****        *** **** |||   ||  ||             ***      ****         ***                                                               ****    ***                                                            |    |          *******                            ***     ***                ****    *****                                    ****  **** | | |        ****  |   |         ****           ****            ****              |   |      |   | ****     ****         |   |                            ****                  ****          ***      ****                   ****                          ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                    |   |                         | |                                             | |                                                                                                    | | |              |   |                    | |   |   |   | | |  |                                | | |    | |                  |   |                     | |    |   |                                 | | |                                  | |                             |   |        |   |                            |   | |   |                         |   |            |   |                 |   |                           |   | |   |                        | |  | | |||   ||  ||             | |                                                                                                                                                            ******                                             | |                                                                                    | | |              |   |                                                          |   |      |   |                       |   |                                                                                                                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                    *****                         | |                                             | |                                                                                                    *****              |   |                    | |   |   |   | | |  |                                *****    | |                  |   |                     | |    *****                                 | | |                                  | |                             *****        |   |                            |   | |   |                         |   |            |   |                 |   |                           ***** |   |                        | |  | | |||   ||  ||             | |                                                                                                                                                                                                               | |                                                                                    *****              *****                                                          |   |      *****                       |   |                                                                                                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                  | |                                             | |                                                                                                    | |                *****                    | |   *****   ********                                | |      | |                  *****                     | |                                          | | |                                  | |                                          *****                            ***** *****                         *****            *****                 *****                                 *****                        | |  ****************             | |                                                                                                                                                                                                               | |                                                                                    | |                                                                               *****                                  *****                                                                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                  ***                                             ***                                                                                                    ***                                         ***                                                   ***      ***                                            ***                                          *****                                  ***                                                                                                                                                                                                                         ***    ***                        ***                                                                                                                                                                                                               ***                                                                                    ***                                                                                                                                                                                                                                                               

chain B : 5'-R(P*GP*GP*GP*GP*G)-3'
JMol viewer RasMol script viewer  CH1 1291A  ..    *
JMol viewer RasMol script viewer  MN 1302A  ..    |
sec str:  .......
sequence :  ..GGGGG
seq num:  ..1272 

chain C : 5'-R(*AP*UP*UP*AP*GP*CP*CP*CP*CP*C)-3'
JMol viewer RasMol script viewer  CH1 1291A  .. *     
JMol viewer RasMol script viewer  U 1283C  ..*|     
sec str:  .........
sequence :  ..AGCCCCC
seq num:  ..1284   

   New search    1n35:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors