triangle PDBeMotif: 1msn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.23.16
Classification hydrolase/hydrolase inhibitor    | release date: Thu, Sep 19, 2002
Title the hiv protease (mutant q7k l33i l63i v82f i84v) complexed 764 (an inhibitor)
Authors A.VELAZQUEZ-CAMPOY, E.FREIR, L.-W.KANG, L.M.AMZEL, S.VEGA, Y.KISO
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search JE2 JE2 binding statistics JE2
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPT
PFNVIGRNLLTQIGCTLNF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POL POLYPROTEIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PFAM:searchPF00077PROSITE PATTERNS:searchPS00141, PROSITE PROFILES:searchPS50175, SUPERFAMILY:searchSSF50630UniProt:searchP03367
JMol viewer RasMol script viewer  JE2 1001B  ..                        * ** * *              ****                              **                 
sec str:  ...ee......eeeeee..eeeeeee......eee.........eeeeeee..eeeeeeeeeeeeeee..eeeeeeeee......eehhhhhhhhh.eee.
sequence :  ..PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPFNVIGRNLLTQIGCTLNF
seq num:  ..1         11        21        31        41        51        61        71        81        91       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || | ^**|  |   |  ||||| ||||             |    |     |  |   |  |                 |   | |||   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || |    |  |   |  |^*** ^***             |    |     |  |   |  |                 |   | |||   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  || |    |  |   |  ||^*****|              ^*****     |  |   |  |                 |   | |^*****
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..   |  || |    |  |   ***^********                         |  |   |  |                 |   | |||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  || |    ****      || |                              |  |   ****                 |   ****|    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |***              || |                              |  |                        |   | | |    
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                 || |                              |  |                        |   | ***    
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                 ****                              ****                        |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ||                                                            *****        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                        **                                                                         

chain B : POL POLYPROTEIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PFAM:searchPF00077PROSITE PATTERNS:searchPS00141, PROSITE PROFILES:searchPS50175, SUPERFAMILY:searchSSF50630UniProt:searchP03367
JMol viewer RasMol script viewer  JE2 1001B  ..                      * * **** *               ***                               *                 
sec str:  ...eee.....eeeeee..eeeeeee.......ee.........eeeeee....eeeeeeeeeeeeee..eeeeeeeee......eehhhhhh....eee.
sequence :  ..PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPFNVIGRNLLTQIGCTLNF
seq num:  ..1         11        21        31        41        51        61        71        81        91       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |    ^**|  |   |  ||||| ||||             |    |            |  |        | |      |   | |||   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |       |  |   |  |^*** ^***             |    |            |  |        | |      |   | |||   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |       |  |   |  ||^*****|              ^*****            |  |        | |      |   | |^*****
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..   |  |       |  |   ***^********                                |  |        | |      |   | |||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |       |  |      ***|                                     |  |        | |      |   | |||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |       ****      || |                                     ****        | |      |   ****|    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |                 || |                                                 ***      |   | | |    
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                 || |                                                          |   | ***    
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                 ****                                                          |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ||                                                            *****        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                        **                                                                         

   New search    1msn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML