triangle PDBeMotif: 1mpu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification immune system    | release date: Thu, Sep 12, 2002
Title crystal structure of the free human nkg2d immunoreceptor
Authors B.J.MCFARLAND, D.BAKER, R.K.STRONG, T.KORTEMME
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search PO4 PO4 binding statistics PO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLV
HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NKG2-D TYPE II INTEGRAL MEMBRANE PROTEIN
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_3.10.100.10PANTHER:searchPTHR22800/searchPTHR22800_SF14PFAM:searchPF00059PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchP26718
JMol viewer RasMol script viewer  PO4 500A  ..                                                *                                    * *                                        
sec str:  ..................ee....eeeeeeeeehhhhhhhhhhhh..ee........hhhhhhh..eeeeeeee......eee...........eee......eeeee...eeeee.....eeeeeee..
sequence :  ..QIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRT
seq num:  ..88        98        108       118       128       138       148       158       168       178       188       198       208     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            |  |               |   |   || |^***    |  ||||||||     | |    |^*** | |||    | ||  |           | |    ^***          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            |  |               |   |   || |||      |  ||||||||     | |    | |   | |||    | ||  |           ^**    | ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            |  |               |   |   || |||      ^***|||||||     | |    | |   | |||    | |^***                  | ||          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            |  |               *****   || |||          |||||||     | |    | |   | |||    | |                      | ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |                       || |||          |||||||     | |    | |   | ***    | |                      ***|          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  |                       || |||          |||||||     | |    | |   *****    | |                      |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |                       *****|          ******|     | |    | |   ****|    | |                      |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |                          ***             |  |     | |    ***     ***    ***                      |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..            ****                                          ****     ***                                            ****          

   New search    1mpu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML