triangle PDBeMotif: 1mmm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Wed, Aug 26, 1998
Title distinct metal environment in iron-substituted manganese superoxide dismutase provides a structural basis of metal specificity
Authors E.N.BAKER, G.B.JAMESON, J.W.WHITTAKER, M.M.WHITTAKER, R.A.EDWARDS
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE   search OH OH binding statistics OH
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDEDISMUTASE);
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF9PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP00448
JMol viewer RasMol script viewer  FE 206A  ..                         *                                                      *                                                                                     *   *                                  
JMol viewer RasMol script viewer  OH 207A  ..                         |                                                      *                                                                *                    * * *                                  
sec str:  .....................hhhhhhhhh.hhhhhhhhhhhhh...hhhhh..hhhhhh.hhh..hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..hhhhhhhhhhhhhh....eeeeeeee..eeeeeeee....hhh.hhhh....eeeeeee..hhh.hhhh...hhhhhhhhhhh..hhhhhhhhhh..
sequence :  ..SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  |        |   |             | || ||  |      | || ||  ||       |   ^*** | ||| ||             |||   |     | | || |    |             || ||| ||   | |        | | |  |  | |||     ||||||| | |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |  |        |   |             | || ||  |      | || ||  ||       |    |   | ||**^*             |||   |     | | || |    |             || ||| ||   | |        | | |  |  | |||     ||||||| | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |        |   |             | ^***|  |      ^*** ||  ||       |    |   | |||  |             |||   |     | | || |    |             || ||| ||   | |        | | |  |  | |||     ||||||| | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |        |   |             |  |  |  |        |  ||  ||       ^*****   | ^*****             |^*****     | | || ^*****             || ||| ||   | |        | | |  |  | |||     ||||||| | |        
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..           |  |        |   |             |  |  |  |        |  ||  ||                |  ||  |             | |   |     | | ||                    || ||| ||   | |        ^***^***  | |||     ||||||| | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |        |   |             |  |  |  |        |  |*****                |  ||  |             | |   |     | | ||                    || ||| ||   | |        | |       | |||     ******| | |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |  |        |   |             |  |  |  |        |  ||  |                 |  ||  |             | |   |     | | ||                    || ||| ||   | |        | |       | |||     ||||||*****        
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |        |   |             |  |  |  |        |  ||  |                 |  ||  |             | |   |     | | ||                    || ||| ||   | |        | |       | |||     ||||||***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |        |   |             ****  |  |        |  |****                 |  ||  |             | |   |     | | ||                    *********   | |        | |       ****|     *****|             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |        |   |                   |  |        |  |                     |  ||  |             | |   |     | | ||                     | |        | |        | |         ***       |  |             
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |        |   |                   |  |        |  |                     |  ||  |             ***   |     | | ||                     | |        ***        | |                   |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..           ****        |   |                   ****        ****                     ********               |   |     | ****                     ***        | |        ***                   ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       |   |                                                                               *****     |   |                                 | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       *****                                                                                         *****                                 | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                           ***                                               

chain B : PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDEDISMUTASE);
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF9PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP00448
JMol viewer RasMol script viewer  FE 206B  ..                         *                                                                                                                                            *   *                                  
JMol viewer RasMol script viewer  OH 208B  ..                         *   *   *                                              *                                                                                     |   *                                  
JMol viewer RasMol script viewer  OH 207B  ..                         |   |   |                                              *                                                                *                    * * *                                  
sec str:  .....................hhhhhhhhh.hhhhhhhhhhhhhhh.hhhh...hhhhhh.hhh..hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..hhhhhhhhhhhhhh....eeeeeeee..eeeeeeee....hhh.hhhh....eeeeeee..hhh.hhhh...hhhhhhhhhhh..hhhhhhhhhh..
sequence :  ..SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  |        |   |             | || ||  ||  || ||||||            |   ^*** | ||| ||              ||   |     | | || |    |             || ||  |    | |        | | |  |  | |||     ||||||| | |     | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |  |        |   |             | || ||  ||  || ||||||            |    |   | ||**^*              ||   |     | | || |    |             || ||  |    | |        | | |  |  | |||     ||||||| | |     | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |        |   |             | ^***|  ||  || ^***||            |    |   | |||  |              ||   |     | | || |    |             || ||  |    | |        | | |  |  | |||     ||||||| | |     | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |        |   |             |  |  |  ||  ||  || ||            ^*****   | ^*****              ^*****     | | || ^*****             || ||  |    | |        | | |  |  | |||     ||||||| | |     | |
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..           |  |        |   |             |  |  |  ||  ||  || ||                     |  ||  |               |   |     | | ||                    || ||  |    | |        ^***^***  | |||     ||||||| | |     | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |        |   |             |  |  |  |*****  || ||                     |  ||  |               |   |     | | ||                    || ||  |    | |        | |       | |||     |*****| | |     | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |  |        |   |             |  |  |  ||  ||  || ||                     |  ||  |               |   |     | | ||                    || ||  |    | |        | |       | |||     ||||||*****     | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |        |   |             |  |  |  ||  ||  || ||                     |  ||  |               |   |     | | ||                    || ||  |    | |        | |       | |||     ||||||***       | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |        |   |             ****  |  |***********|                     |  ||  |               |   |     | | ||                    ********    | |        | |       ****|     *****|          | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |        |   |                   |  |        |  |                     |  ||  |               |   |     | | ||                     | |        | |        | |         ***       |  |          | |
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |        |   |                   |  |        |  |                     |  ||  |               |   |     | | ||                     | |        ***        | |                   |  |          ***
search RasMol script viewer Motif-ligand binding stats  niche ..           ****        |   |                   ****        ****                     ********               |   |     | ****                     ***        | |        ***                   ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       |   |                                                                               *****     |   |                                 | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       *****                                                                                         *****                                 | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                           ***                                               

   New search    1mmm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors