triangle PDBeMotif: 1lww  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.2.
Classification hydrolase/dna    | release date: Mon, Jun 3, 2002
Title borohydride-trapped hogg1 intermediate structure co- crystallized with 8-bromoguanine
Authors G.L.VERDINE, J.C.FROMME, M.KARPLUS, S.D.BRUNER, W.YANG
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search BRG BRG binding statistics BRG   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
AMADIGSEGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKS
QASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLC
QAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKALCIL
PGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADL
RQSR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 8-OXOGUANINE DNA GLYCOSYLASE
member of: CATH:search1.10.1670.10/search1.10.340.30/search3.30.310.40GENE3D:searchG3DSA_1.10.1670.10/searchG3DSA_1.10.340.30/searchG3DSA_3.30.310.40PANTHER:searchPTHR10242/searchPTHR10242_SF2PFAM:searchPF00730/searchPF07934SMART:searchSM00478SUPERFAMILY:searchSSF48150/searchSSF55945TIGRFAMS:searchTIGR00588UniProt:searchO15527
JMol viewer RasMol script viewer  BRG 328A  ..                                 *  *                                  ..                                                                *    *  *                                                                                             *                * *  *                                           *   *      
JMol viewer RasMol script viewer  CA 216E  ..                                 |  |                                  ..                                                                |    |  |                                                                                             |                | |  |                                           |   |      
sec str:  ............hhhhheeee......hhhhhh........eeee..eeeeee..eeeeeee...eeeeeee.........hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhh....hhhhhhhhhhhhhhhhh.eeeee..eeee...hhhhhh..hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhh.....hhhhhhhhhhhhh........hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.
sequence :  ..GSEGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYR..SQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQ
seq num:  ..9         19        29        39        49        59        69         ..83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |      |  |||  ||  |||^**|   |  |            | || |      |..      |  |       |||||       | |||| |       |  |             || || | |   |       |  |      | |         |  | | |  || |||| |      ^**     | |      |  || | |  || ||  || |  |      | |  |   | |        | |    | | | | |^**|                           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |      |  |||  ||  |||| ||   |  |            ^*** |      |..      ^***       |||||       | |||| |       |  |             || || | |   |       |  |      | |         |  | | |  || |||| |              | |      |  ^*** |  || ||  || |  |      | |  |   | |        | |    | | | | |^***                           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |      |  |||  ||  |||| ||   |  |              |  |      |..                 |||||       | ^*****       |  |             || || | |   |       |  |      | |         |  | | |  || |||| |              | |      |  ||   |  || ||  |^*****      | |  |   | |        | |    | | | | ||                              
search RasMol script viewer Motif-ligand binding stats  RGD ..          |  |      |  |||  ||  |||| ||   |  |              |  |      *..                 |||||       | ||||         |  |             || || | |   |       |  |      | |         |  | | |  || |||| |              | |      |  ||   |  || ||  |  |         | |  |   | |        | |    | | | | ||                              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |      **********  |||| ||   |  |              |  |       ..                 |||||       *****|         |  |             || || | |   |       |  |      | |         |  | | |  || |||| |              | |      |  ||   |  || ||  |  |         | |  |   | |        | |    | | | | ||                              
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |      |  | |  |   |||| ||   |  |              |  |       ..                 |||||       | || |         |  |             || || | |   |       |  |      | |         |  | | |  || |||| |              | |      |  ||   |  || ||  |  |         | |  |   ***        | |    | | | | ||                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****      **** ****   |||| ||   ****              |  |       ..                 |||||       **** |         |  |             ******* |   |       |  |      | |         |  | | |  |********              | |      |  ||   |  ****|  |  |         | |  |   |          | |    | | | | ||                              
search RasMol script viewer Motif-ligand binding stats  nest ..                                **** ||   |  |              |  |       ..                 ****|         |  |         |  |              |  |   |   |       |  |      | |         |  | ***  |  ****                ***      |  ||   |   |  |  |  |         ***  |   |          ***    | | | | ||                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                   ****   ****              ****       ..                  ****         ****         ****              ****   |   |       ****      ***         ****      |    |                 ***      ****|   |   *******  |           ****   |                 *** | | ||                              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                   | |                                 ..                                                                     |   |                                       ******                              |   |            |                  |                     | | ||                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                   | |                                 ..                                                                     |   |                                                                           *****            |                  |                     | | ||                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                   | |                                 ..                                                                     *****                                                                                            |                  |                     ******                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                   ***                                 ..                                                                                                                                                                      |                  |                       ***                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                       ..                                                                                                                                                                      *                  *                                                         

chain D : 5'-D(*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3';
sec str:  .................
sequence :  ..GGTAGACCTGGACGC
seq num:  ..1         11   

chain E : 5'-D(*GP*CP*GP*TP*CP*CP*AP*(PED)P*GP*TP*CP*TP*AP*CP*C)-3';
JMol viewer RasMol script viewer  BRG 328A  ..       *       
JMol viewer RasMol script viewer  CA 216E  ..      *|       
sec str:  .................
sequence :  ..GCGTCCAPGTCTACC
seq num:  ..16        26   

   New search    1lww:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors