triangle PDBeMotif: 1lvk  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification contractile protein    | release date: Fri, Sep 5, 1997
Title x-ray crystal structure of the mg (dot) 2'(3')-o-(n- methylanthraniloyl) nucleotide bound to dictyostelium discoideum myosin motor domain
Authors C.B.BAUER, C.R.BAGSHAW, I.RAYMENT, P.A.KUHLMAN
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search BEF BEF binding statistics BEF   search MNT MNT binding statistics MNT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTSDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTSERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEKYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFLTVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYDLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MYOSIN
member of: GENE3D:searchG3DSA_2.30.30.360/searchG3DSA_4.10.270.10PANTHER:searchPTHR13140/searchPTHR13140_SF305PFAM:searchPF00063/searchPF02736PRINTS:searchMYOSINHEAVYPROSITE PROFILES:searchPS50096/searchPS51456, SMART:searchSM00015/searchSM00242SUPERFAMILY:searchSSF50084/searchSSF52540UniProt:searchP08799
JMol viewer RasMol script viewer  BEF 1000A  ..                                                                                                                                                                                   *   *                    ..BEF ..                        *  **                                                                                                                                                                                                                                                                       ..BEF ..                                                                                                                  ..                                                                                                                                     
JMol viewer RasMol script viewer  MNT 999A  ..                                                                                                                             ** *    *                                            ********                  ..MNT ..                        ***||                                                                                                                                                                                                                                                                       ..MNT ..                                                                                                                  ..                                                                                                                                     
JMol viewer RasMol script viewer  MG 998A  ..                                                                                                                             || |    |                                            ||||||*|                  ..MG ..                        ||||*                                                                                                                                                                                                                                                                       ..MG ..                                                                                                                  ..                                                                                                                                     
sec str:  ..........hhhhhh.........hhhh.....eeee..........eeeeeeee...eeeee.....eeeeehhh......hhh.....hhh.....hhhhhhhhhhhhhh...eeee..eeeee..........hhhhhhh....hhh....hhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhhh........ ...hhhhhhhhhhhhhhhhh.............eeeeeeee.....eeeeeeeee...hhhh..........hhhhhhhhh..hhhhhhh....hhh................hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh................hhhhhhhhhh...hhhhhhhhh..eee....eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... ....hhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhh......eee......eeeeee..eeeeee...hhhhhh....hhhhhhhhh...hhhhhhhh.hhhh........hhhhhhhhhhhhhhhhhh.eeeeeeee............hhhhhhhhhh..hhhhhhhhhh...eeeehhhhhhhhhhh..........hhhhhhhhhhhh...hhheee...eeee...hhhhhh....
sequence :  ..NPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTSDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQA... ..GVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTSERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDEDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQFFNHHMFKVEQEKYLKEKIN... ..LDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRA..FLTVAAQYKEQLASLMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYDLAPNVPRDAEDSQKATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202 ... ..209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489         ... ..508       518       528       538       548       558       568       578       588       598       608       618 ..627       637       647       657       667       677       687       697       707       717       727       737       747          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||| |   || |     | | | |||||           | |      ||      | |  | |    || ||    || || | || ||              || ||| |   | |    | |   |  |   || || ||| ||             |  || |^***   || |||||| | |      |  |    ..PS00001..*              | ||  ||||^***|         | |||          | | |  | | |||        |  ||  ||  ||| || ||   ^***|  |  ||  ||          | || ||| |         || ||    | | ||   | | |   |  |||  || |          | |        |   | ||                   |  || |          || |            ^***                     | |^..PS00001.. | |    |  |          | || | ^***| | |   | ||||| ||  |  | ||    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               ||||  | || ||| |          || ||         | |      | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||| |   || |     | | | ||^**           | |      ||      ^**  | |    || ||    || || | || ||              || ||| |   | |    | |   |  |   || || ||| ||             |  || |       || |||||| ^**      |  |    ..PS00005..               | ||  ^**| |^**         | |||          | | |  | | ^**        |  ||  ||  ||| || ||     | |  |  ||  ||          | || ||| |         || ||    | | ||   | | |   |  |||  || |          | |        |   ^**|                   |  |^**          || |                                     | | ..PS00005.. | |    |  |          | || |  || | | |   | |^**| ||  |  | ||    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               ||||  | |^**|| |          || ||         ^**      | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| ||| |   || |     | | | ^***|           | |      ||           | |    || ||    || || | || ||              || ||| |   | |    | |   |  |   || || ||| ||             ^***| |       || ||||||          |  |    ..PS00006..               | ||  |||| |            | |||          | | |  | ^***         |  |^***|  ||| || ||     | |  |  |^***|          | |^***| |         || ||    | | ||   | | |   |  |||  ^***          | |        |   ^***                   |  |             ^***                                     | | ..PS00006.. | |    |  |          | || |  || | | |   | ||||| ||  |  ^***    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               ||||  | || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|| ||*******^ |     | | |  || |           | |      ||           | |    || ||    || || | || ||              *******^   | |    | |   |  |   || || ||| ||                 | |       || ||||||          |  |    ..PS00007..               | ||  |||| |            | |||          | | |  | |  |         |  ||  ||  ||| || ||     | |  |  ||   |          | || | | |         || ||    | | ||   | | |   |  |||   |            | |        |   |                      |  |              | |                                     | | ..PS00007.. | |    |  |          | || |  || | | |   | ||||| ||  |  | ||    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               ||||  | || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||  |   |  |     | | |  || |           | |      ||           | |    || ||    || || | || ||              || ||| |   | |    | |   |  |   || || ||| ||                 | |       || ^*****          |  |    ..PS00008..               | ^*****|| |            | |||          | | |  | |  |         |  ||  ||  ||| || ||     | |  |  ||   |          | || | | |         || ||    ^*****   | | |   |  |^*****            | |        |   |                      |  |              | |                                     | | ..PS00008.. | |    |  |          | || |  || | | |   | ||||| ||  |  | ||    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               |^***** || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|| ||  |   |  |     | | |  || |           | |      ||           | |    || ||    || || | || ||              || ||| |   | |    | |   |  |   || |^***| ||                 | |       || |||||           |  |    ..PS00009..               |  |  | || |            | |||          | | |  | |  |         |  ||  ||  ||| || ||     | |  |  ||   |          | || | | |         || ||      | |    | | |   |  | |                | |        |   |                      |  |              | |                                     | | ..PS00009.. | |    |  |          | || |  || | | |   | ||||| ||  |  | ||    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               ||||    || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|| ||  |   |  |     | | |  || |           | |      ||           | |    || ||    || || | || ||              || ||| |   | |    | |   |  |   || || ||| ||                 | |       ********           |  |    ..PS00017..               |  |  | || |            | |||          | | |  | |  |         |  ||  ||  ||| || ||     | |  |  ||   |          | || | | |         || ||      | |    | | |   |  | |                | |        |   |                      |  |              | |                                     | | ..PS00017.. | |    |  |          | || |  || | | |   | ||||| ||  |  | ||    |  |    ||||||              |  | | |   |  | ||||  ..  |   |  |   |   || ||          | | |               ||||    || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****  |   |  |     | | |  || |           | |      ||           | |    *****    || || | || ||              || ||| |   | |    | |   |  |   || || |*****                 | |        | |||||           |  |    ..alphabetamotif..               |  |  | || |            | |||          | | |  | |  |         |  ||  |*****| || ||     | |  |  ||   |          | || | | |         || ||      | |    | | |   |  | |                | |        |   |                      |  |              | |                                     | | ..alphabetamotif.. | |    |  |          | || |  || | | |   | ||||| ||  |  | ||    |  |    ||||||              |  | | |   |  *****|  ..  |   |  |   |   || ||          | | |               ||||    || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| ||  |   |  |     | | |  || |           | |      ||           | |    || ||    || || | || ||              || ||| |   | |    ***   |  |   || || ||| ||                 | |        | |||||           |  |    ..asxturn..               |  |  | |***            | |||          | | |  | |  |         |  ||  ||  | | || ||     | |  |  ||   |          | || | | |         || ||      | |    *** |   |  | |                | |        |   |                      |  |              | |                                     | | ..asxturn.. | |    |  |          | || |  || | | |   | ||||***|  |  | ||    |  |    ||||||              |  | ***   |  | || |  ..  |   |  |   |   || ||          *** |               ***|    || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..|| ||  |   |  |     | | |  || |           | |      **           | |    || ||    || || | || ||              || ||| |   | |          |  |   || || ||| ||                 | |        | |||||           |  |    ..betabulge..               |  |  | ||              | |||          | | |  | |  |         |  ||  ||  | | || ||     | |  |  ||   |          | || | | |         || ||      | |        |   |  | |                | |        |   |                      |  |              | |                                     | | ..betabulge.. | |    |  |          | || |  || | | |   | |||||  |  |  | ||    |  |    ||||||              |  | |     |  | || |  ..  |   |  |   |   || ||            | |               ||||    || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..|| ||  |   |  |     | | |  || |           | |                   | |    || ||    || || | || ||              || ||| |   | |          |  |   || || ||| ||                 | |        | |||||           |  |    ..betabulgeloop..               |  |  | ||              *****          | | |  | |  |         |  ||  ||  | | || ||     | |  |  ||   |          | || | | |         || ||      | |        |   |  | |                | |        |   |                      |  |              | |                                     | | ..betabulgeloop.. | |    |  |          | || |  || | | |   | |||||  |  |  | ||    |  |    ||||||              |  | |     |  | || |  ..  |   |  |   |   || ||            | |               ||||    || ||| |          || ||                  | ||||| ||           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..********   |  |     | | |  || |           | |                   | |    ****|    ***** | *****              *****| |   | |          |  |   || || |****|                 | |        ****|||           |  |    ..betaturn..               |  |  | ||              ****|          | | |  | |  |         |  |******** | *****     | |  ****|   |          | || | | |         ****|      | |        |   |  | |                | |        |   |                      |  |              | |                                     | | ..betaturn.. | |    |  |          **** ****| | | |   | ****|  |  |  | ||    ****    |****|              |  | |     |  **** |  ..  |   |  |   |   *****            | |               ||||    *****| |          ****|                  ****|****|           | |  ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |  |   |  |     | | |  || |           | |                   | |     |  |     | || |  |  |              |  | | |   | |          |  |   || || | |  |                 | |          |||||           |  |    ..gammaturn..               |  |  | ||                | |          *** |  | |  |         |  |       | |  |  |     | |  |  ||   |          | || | | |          |  |      | |        |   |  | |                | |        |   |                      |  |              | |                                     | | ..gammaturn.. | |    |  |            |  |  || | | |   |  || |  |  |  | ||            | || |              |  | |     |  | |  |  ..  |   |  |   |    |  |            | |               ||||         | |           |  |                    | | |  |           | |  |  |  
search RasMol script viewer Motif-ligand binding stats  nest .. |  |  |   |  |     | | |  || |           ***                   ***     |  |     | || |  |  |              |  *** |   | |          |  |   || || | |  |                 ***          *****           |  |    ..nest..               |  |  | ||                ***              |  | |  |         |  |       ***  |  |     ***  |  ||   |          ***| | | |          |  |      | |        |   |  ***                | |        |   |                      |  |              | |                                     *** ..nest.. ***    |  |            |  |  || | | |   |  |***  |  |  | ||            | |***              |  | |     |  | |  |  ..  |   |  |   |    |  |            ***               ****         | |           |  |                    *** |  |           ***  |  |  
search RasMol script viewer Motif-ligand binding stats  niche .. *******   ****     | | *******           ***                           ****     ******  ****              |    ***   ***          ****   |****** ****                              |               ****    ..niche..               ****  ****                                 **** ****         ****            ****     | |  ****|   |             | | | |          ****      ***        |   |                     ***        |   |                      ****              | |                                         ..niche..        ****            *******| | | |   ****  ****  *******            ***                 ******     **** ****  ..  |   |  |   |    ****                                           ***           ****                        ****                ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..       |   |        | |                                                                                    ******                     |   |                                         |                       ..schellmannloop..                     | ||                                                                            | |      |   |             | | | |                               |   |                                |   |                                        | |                                         ..schellmannloop..                               | | | |                  | |                                    | |                ..  |   |  |   |                                                                                                                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..       *****        | |                                                                                                               *****                                         |                       ..stmotif..                     | ||                                                                            | |      *****             ***** |                               |   |                                |   |                                        | |                                         ..stmotif..                               ***** |                  | |                                    | |                ..  *****  |   |                                                                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                    | |                                                                                                                                                             |                       ..ststaple..                     | ||                                                                            | |                          *****                               *****                                *****                                        | |                                         ..ststaple..                                 *****                  | |                                    | |                ..         *****                                                                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                                                                                                                                                             |                       ..stturn..                     ***|                                                                            ***                                                                                                                                                | |                                         ..stturn..                                                        ***                                    ***                ..                                                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                    *                       ..REP00000..                        *                                                                                                                                                                                                                               * *                                         ..REP00000..                                                                                                                  ..                                                                                                                                     

   New search    1lvk:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML