triangle PDBeMotif: 1ljm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription    | release date: Mon, Apr 22, 2002
Title dna recognition is mediated by conformational transition and by dna bending
Authors D.BARTFELD, D.LEVANON, D.RABINOVICH, F.FROLOW, G.C.COUTURE, L.SHIMON, Y.GRONER, Z.SHAKKED
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVAR
FNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RUNX1 TRANSCRIPTION FACTOR
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
JMol viewer RasMol script viewer  CL 4003A  ..                                                   *  **                     *                                    
sec str:  ...eee.....eeee....eee.........eeee........eeeeeee........ee..eee....eee....ee..........eeeeee.....eeee.....eee.....
sequence :  ..ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPR
seq num:  ..1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  |         | ^***            | ||   |  ||  ^***   ^***               | ||| ||                             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |         |  |              | ||   |  ||  ||     | |                | ^** ||                             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |         |  |              | ^*****  ^*****     | |                |  |  ||                             
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      |  |         |  |              |  |       |  |      | |                ********                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |         |  |              ****       |  |      | |                   |  |                              
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |         |  |              |  |       |  |      ***                   |  |                              
search RasMol script viewer Motif-ligand binding stats  niche ..      ****         ****              ****       ****                            ****                              

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RUNX1 TRANSCRIPTION FACTOR
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
JMol viewer RasMol script viewer  CL 4005B  ..                                                                                  *                          **   
JMol viewer RasMol script viewer  CL 4004B  ..                                                    *  *                      *   |                          ||   
JMol viewer RasMol script viewer  CL 4002B  ..                                   * *              |  |                      |   |                          ||   
JMol viewer RasMol script viewer  CL 4001B  ..                                   | |              |  |                      |   |            *             ||   
sec str:  .....ee.....eee.....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeee.....eee....
sequence :  ..GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
seq num:  ..2060      2070      2080      2090      2100      2110      2120      2130      2140      2150      2160          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |  |         | ^***         | || ||   |  || |^***   ^***               | ||| ||                            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  |         |  |           | || ||   |  || ||||    | |                | ^** ||                            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |  |         |  |           | || ^*****  ^*****|    | |                |  |  ||                            
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..     | |  |         |  |           | ||  |       | || |    | |                ********                            
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |  |         |  |           | ||  |       ******    | |                   |  |                             
search RasMol script viewer Motif-ligand binding stats  nest ..     | |  |         |  |           ***|  |       |  |      ***                   |  |                             
search RasMol script viewer Motif-ligand binding stats  niche ..     ******         ****              ****       ****                            ****                             
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                                                          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RUNX1 TRANSCRIPTION FACTOR
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
JMol viewer RasMol script viewer  CL 4003A  ..                                                   *  **                     *                                    
sec str:  ...eee.....eeee....eee.........eeee........eeeeeee........ee..eee....eee....ee..........eeeeee.....eeee.....eee.....
sequence :  ..ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPR
seq num:  ..1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  |         | ^***            | ||   |  ||  ^***   ^***               | ||| ||                             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |         |  |              | ||   |  ||  ||     | |                | ^** ||                             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |         |  |              | ^*****  ^*****     | |                |  |  ||                             
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      |  |         |  |              |  |       |  |      | |                ********                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |         |  |              ****       |  |      | |                   |  |                              
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |         |  |              |  |       |  |      ***                   |  |                              
search RasMol script viewer Motif-ligand binding stats  niche ..      ****         ****              ****       ****                            ****                              

chain B : RUNX1 TRANSCRIPTION FACTOR
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
JMol viewer RasMol script viewer  CL 4005B  ..                                                                                  *                          **   
JMol viewer RasMol script viewer  CL 4004B  ..                                                    *  **                     *   |                          ||   
JMol viewer RasMol script viewer  CL 4002B  ..                                   * *              |  ||                     |   |               *          ||   
JMol viewer RasMol script viewer  CL 4001B  ..                                   | |              |  ||                     |   |           **  |          ||   
sec str:  .....ee.....eee.....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeee.....eee....
sequence :  ..GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
seq num:  ..2060      2070      2080      2090      2100      2110      2120      2130      2140      2150      2160          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |  |         | ^***         | || ||   |  || |^***   ^***               | ||| ||                            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  |         |  |           | || ||   |  || ||||    | |                | ^** ||                            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |  |         |  |           | || ^*****  ^*****|    | |                |  |  ||                            
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..     | |  |         |  |           | ||  |       | || |    | |                ********                            
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |  |         |  |           | ||  |       ******    | |                   |  |                             
search RasMol script viewer Motif-ligand binding stats  nest ..     | |  |         |  |           ***|  |       |  |      ***                   |  |                             
search RasMol script viewer Motif-ligand binding stats  niche ..     ******         ****              ****       ****                            ****                             
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                                                          

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RUNX1 TRANSCRIPTION FACTOR
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
JMol viewer RasMol script viewer  CL 4005B  ..                                                                                  *                          **   
JMol viewer RasMol script viewer  CL 4004B  ..                                                    *  **                     *   |                          ||   
JMol viewer RasMol script viewer  CL 4002B  ..                                   * *              |  ||                     |   |               *          ||   
JMol viewer RasMol script viewer  CL 4001B  ..                                   | |              |  ||                     |   |           **  |          ||   
sec str:  .....ee.....eee.....eee.........eeee........eeeeeee............eee....eee................eeeeee.....eeee.....eee....
sequence :  ..GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGP
seq num:  ..2060      2070      2080      2090      2100      2110      2120      2130      2140      2150      2160          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |  |         | ^***         | || ||   |  || |^***   ^***               | ||| ||                            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  |         |  |           | || ||   |  || ||||    | |                | ^** ||                            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |  |         |  |           | || ^*****  ^*****|    | |                |  |  ||                            
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..     | |  |         |  |           | ||  |       | || |    | |                ********                            
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |  |         |  |           | ||  |       ******    | |                   |  |                             
search RasMol script viewer Motif-ligand binding stats  nest ..     | |  |         |  |           ***|  |       |  |      ***                   |  |                             
search RasMol script viewer Motif-ligand binding stats  niche ..     ******         ****              ****       ****                            ****                             
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                                                          

   New search    1ljm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML