triangle PDBeMotif: 1lbi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription regulation    | release date: Sat, Feb 17, 1996
Title lac repressor
Authors G.CHANG, H.C.PACE, M.A.KERCHER, M.LEWIS, N.C.HORTON, P.LU
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF00356/searchPF13377PRINTS:searchHTHLACIPROSITE PATTERNS:searchPS00356, PROSITE PROFILES:searchPS50932, SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
sec str:  ...eeeeee.....hhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhhh....eeee......hhhhhhh.......eeeee........eeee..hhhhhhhhhhhh......eeee......hhhhhhhhhhhhhh........eeee....hhhhhhhhhhhh......eeeee..hhhhhhhhhhhhh.........eeeeee....hhh.....eeee..hhhhhhhhhhhhhhhhh......eee...eee...............hhhhhhhhhhhhhhhhhh
sequence :  ..LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLE
seq num:  ..62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |   ||| |           |  | | |    |  | || |  |     |  | | |    |  | |     |  | |        |  | |    ||| ||||| |   | |||            || ||           | |        | |   |  || ||  |||   |          |   ||  |||  ||  |                  | |     |  || |   |  | | |           **^*|        | |     |  ||   |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   ||| |           |  | | |    |  | || |  |     |  | | |    |  | |     |  | |        |  | |    ||| ||||| |   | |||            |^**|           | |        | |   |  || ||  |||   |          |   ||  |||  ||  |                  ^**     |  || |   |  | | |            |  |        ^**     |  ||   |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   ||| |           ^*** | |    ^*** ^***  |     |  | | |    |  | |     |  | |        |  | |    |^***|||| |   | |||            |  ||           | |        | |   |  || ||  |||   |          |   ||  |||  ||  |                          |  ^***   |  | | |            |  |                |  ||   ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ^*****| |                | |       | |^*****     |  | | ^*****  | |     |  | |        |  | |    | | |^*****   | |||            |  ||           | |        | |   |  || ||  |^*****          ^*****  |^*****  |                          |   |     |  | | |            |  |                |  ||       
search RasMol script viewer Motif-ligand binding stats  HTH_LACI_1 ..       | | |                | |       | |           |  | |         | |     |  | |        |  | |    | | | |||     | |||            |  ||           | |        | |   |  || ||  | |                  |   | |  |   |                          |   |     |  | | |            |  |                |  ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | | |                | |       | |           |  | |         | |     |  | |        |  | |    | | *****     | |||            *****           | |        | |   |  *****  | |                  |   | |  |   |                          |   |     |  | | |            |  |                *****       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | | |                | |       | |           |  | |         | |     |  | |        |  | |    | | | ||      | |||            |  |            | |        ***   |  || |   | |                  |   | |  |   |                          |   |     |  | | |            |  |                |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | | |                | |       | |           **** |         | |     **** |        **** |    | | ****      ****|            ****            | |        | |   |  ****   | |                  |   | |  |   |                          |   |     **** | |            |  |                ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | | |                | |       ***              | |         ***        ***        |  ***    ***   |         | |                            | |        | |   |   |     | |                  |   | |  |   |                          |   |          ***            |  |                            
search RasMol script viewer Motif-ligand binding stats  nest ..       | ***                ***                        ***                               |  |        |   |         ***                            ***        ***   |   |     ***                  |   ***  |   |                          |   |                         |  |                            
search RasMol script viewer Motif-ligand binding stats  niche ..       | |                                                                               ****        |   |                                                     |   |   |                          |   |    |   |                          |   |                         ****                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..       | |                                                                                           |   |                                                     *****   |                          |   |    |   |                          |   |                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..       | |                                                                                           *****                                                         *****                          *****    *****                          *****                                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..       ***                                                                                                                                                                                                                                                                                              

chain B : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF00356/searchPF13377PRINTS:searchHTHLACIPROSITE PATTERNS:searchPS00356, PROSITE PROFILES:searchPS50932, SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
sec str:  ...eeeeee.....hhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhhh....eeee......hhhhhhh.......eeeee........eeee..hhhhhhhhhhhh......eeee......hhhhhhhhhhhhhh........eeee....hhhhhhhhhhhh......eeeee..hhhhhhhhhhhhh.........eeeeee....hhh.....eeee..hhhhhhhhhhhhhhhhh......eee...eee...............hhhhhhhhhhhhhhhhhh
sequence :  ..LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLE
seq num:  ..62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |    |          |   | || |||    |  | || |  |        | | |    |      |  ||             |  |       || |||   |   | |||        |  | | |  ||     |  | |        | |   |         |||   |          |    |  |||  ||  |        || ||     | |     |  || | |  |                 **^*|   | |  | ||   |    |   |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |    |          |   | || |||    |  | || |  |        | | |    |      |  ||             |  |       || |||   |   | |||        |  | ^**  ||     |  | |        | |   |         |||   |          |    |  |||  ||  |        || ||     ^**     |  || | |  |                  |  |   | |  ^**|   |    |   |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |    |          |   ^*** |||    ^*** ^***  |        | | |    |      |  ||             |  |       ^***||   |   | |||        |  |   |  ||     |  | |        | |   |         |||   |          |    |  |||  ||  |        || ||             |  ^*** |  |                  |  |   | |     |   |    |   ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ^*****          |   | || |||          ^*****        | | ^*****      |  ||             |  |        |  ^*****   | |||        |  |   |  ||     |  | |        | |   |         |^*****          ^*****  |^*****  |        || ||             |   |   |  |                  |  |   | |     |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  HTH_LACI_1 ..                   |   | || |||                        | |             |  ||             |  |        |   |       | |||        |  |   |  ||     |  | |        | |   |         | |                      | |  |   |        || ||             |   |   |  |                  |  |   | |     |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |   | || |||                        | |             *****             |  |        |   |       | |||        |  |   *****     |  | |        | |   |         | |                      | |  |   |        || ||             |   |   |  |                  |  |   | |     |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |   | |****|                        | |             ****              |  |        |   |       ****|        |  |   ****      **** |        | |   |         | |                      | |  |   |        ****|             |   |   ****                  |  |   | |     |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..                   |   | |  ***                        ***                               |  |        |   |         ***        |  |                ***        ***   |         ***                      ***  |   |         |  |             |   |                         |  |   ***     |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..                   |   | |    |                                                          ****        |   |                    ****                             |   |                                       |   |         ****             |   |                         ****           |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   |   | ******                                                                      |   |                                                     |   |                                       |   |                          |   |                                        |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   |   |                                                                             |   |                                                     *****                                       |   |                          |   |                                        |   |    |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   *****                                                                             *****                                                                                                 *****                          *****                                        *****    *****   

chain C : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF00356/searchPF13377PRINTS:searchHTHLACIPROSITE PATTERNS:searchPS00356, PROSITE PROFILES:searchPS50932, SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
sec str:  ...eeeeee.....hhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhhh....eeee......hhhhhhh.......eeeee........eeee..hhhhhhhhhhhh......eeee......hhhhhhhhhhhhhh........eeee....hhhhhhhhhhhh......eeeee..hhhhhhhhhhhhh.........eeeeee....hhh.....eeee..hhhhhhhhhhhhhhhhh......eee...eee...............hhhhhhhhhhhhhhhhhh
sequence :  ..LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLE
seq num:  ..62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |    || | | |||     | || |||    |  | || |  |     || ||| |    | |        || || |        | |       || |||   |     | |        |  | | |            | |        | |   |   |     |||   |          |    |  |||  ||  |        || ||     | | |  ||  || ||| |||                **^*|   | || | |            || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |    || | | |||     | || |||    |  | || |  |     || ||| |    | |        || || |        | |       || |||   |     | |        |  | ^**            | |        | |   |   |     |||   |          |    |  |||  ||  |        || ||     ^** |  ||  || ||| |||                 |  |   | || ^**            || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |    || | | |||     ^*** |||    ^*** ^***  |     || ||| |    | |        || || |        | |       ^***||   |     | |        |  |                | |        | |   |   |     |||   |          |    |  |||  ||  |        || ||         |  ||  ^***|| |||                 |  |   | || |              |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ^*****| | | |||       || |||          ^*****     || ||| ^***** |        || || |        | |        |  ^*****     | |        |  |                | |        | |   |   |     |^*****          ^*****  |^*****  |        || ||         |  ||  ||  || |||                 |  |   | || |              |  | 
search RasMol script viewer Motif-ligand binding stats  HTH_LACI_1 ..         | | | |||       || |||                     || |||      | |        || || |        | |        |   |         | |        |  |                | |        | |   |   |     | |                      | |  |   |        || ||         |  ||  ||  || |||                 |  |   | || |              |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | | *****       || |||                     || |||      | |        || || |        | |        |   |         | |        |  |                | |        | |   |   |     | |                      | |  |   |        || ||         |  ||  ||  *****|                 |  |   | || |              |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | | | ||        || |||                     || |||      | |        || || |        | |        |   |         | |        |  |                | |        | |   |   |     | |                      | |  |   |        || ||         |  ||  ||  || | |                 |  |   ***| |              |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | | ****        |****|                     |****|      | |        *******        | |        |   |         | |        ****                | |        | |   |   |     | |                      | |  |   |        ****|         ****|  ||  **** |                 |  |      | |              **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |   |         |  | |                     |  | |      ***         | || |        ***        |   |         | |        |  |                | |        | |   |   |     | |                      | |  |   |         |  |            ||  ||   |   |                 |  |      | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..         ***   |         |  ***                     |  ***                  | || |                   |   |         ***        |  |                ***        ***   |   |     ***                      ***  |   |         |  |            ||  ||   |   |                 |  |      ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |         |    |                     |    |                  ******                   |   |                    ****                                 |   |                                   |   |         ****            ||  ||   |   |                 ****                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           |   |         ******                     ******                                           |   |                                                         |   |                                   |   |                         ||  ||   |   |                                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                                                     *****                                                         *****                                   *****                         ******   *****                                                 

chain D : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF00356/searchPF13377PRINTS:searchHTHLACIPROSITE PATTERNS:searchPS00356, PROSITE PROFILES:searchPS50932, SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
sec str:  ...eeeeee.....hhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhhh....eeee......hhhhhhh.......eeeee........eeee..hhhhhhhhhhhh......eeee......hhhhhhhhhhhhhh........eeee....hhhhhhhhhhhh......eeeee..hhhhhhhhhhhhh.........eeeeee....hhh.....eeee..hhhhhhhhhhhhhhhhh......eee...eee...............hhhhhhhhhhhhhhhhhh
sequence :  ..LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLE
seq num:  ..62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |   ||| |   |       |  | | |    |  | || |  |     || ||| |    | |||| ||                |  |       || ||||| |  || ||| |      |  | | |||    |  || | |        | |   |   |     |||   |          |    |  |||  || ||        || ||     | | | |||  || |      ||||            **^*| |  |   | ||   |        |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   ||| |   |       |  | | |    |  | || |  |     || ||| |    | |||| ||                |  |       || ||||| |  || ||| |      |  | ^**||    |  || | |        | |   |   |     |||   |          |    |  |||  || ||        || ||     ^** | |||  || |      ||||             |  | |  |   ^**|   |        |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   ||| |   |       ^*** | |    ^*** ^***  |     || ||| |    | |||| ||                |  |       ^***|||| |  || ||| |      |  | |  ||    |  || | |        | |   |   |     |||   |          |    |  |||  || ||        || ||         | |||  ^***      ||||             |  | |  |      |   |        ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ^*****| |   |            | |          ^*****     || ||| ^***** |||| ||                |  |        | |^*****  || ||| |      |  | |  ||    |  || | |        | |   |   |     |^*****          ^*****  |^***** ||        || ||         | |||  ||        ||||             |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  HTH_LACI_1 ..       | | |   |            | |                     || |||      | |||| ||                |  |        | | |||    || ||| |      |  | |  ||    |  || | |        | |   |   |     | |                      | |  |  ||        || ||         | |||  ||        ||||             |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | | |   |            | |                     || |||      | ||*****                |  |        | *****    || ||| |      |  | *****    ***** | |        | |   |   |     | |                      | |  |  ||        || ||         | |||  ||        ||||             |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | | |   |            | |                     || |||      | |||| |                 |  |        | | ||     || ||| |      |  | |  |     |  |  | |        ***   |   |     | |                      | |  |  ||        || ||         ***||  ||        ||||             |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | | |   |            | |                     *****|      | ||****                 |  |        | ****     |****| |      **** ****     ******* |        | |   |   |     | |                      | |  |  ||        ****|            ||  ||        ||||             |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | | |   |            | |                        | |      ******                   |  |        |   |      |  | | |      |  |                | |        | |   |   |     | |                      | |  |  ||         |  |            ||  ||        |***             |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..       | ***   |            ***                        ***                               |  |        |   |      |  *** |      |  |                ***        ***   |   |     ***                      ***  |  ||         |  |            ||  ||        | |              |  | |  |      |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..       | | |   |                                                                         ****        |   |      |    ***      ****                                 |   |                                   ****|         ****            ||  ||        ***              **** ****      |   |            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..       | | |   |                                                                                     |   |      ******                                             |   |                                   |   |                         ||  ||                                        |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..       | | *****                                                                                     *****                                                         *****                                   *****                         ******                                        *****            
search RasMol script viewer Motif-ligand binding stats  stturn ..       ***                                                                                                                                                                                                                                                                                              

   New search    1lbi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML