triangle PDBeMotif: 1l8d  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification replication    | release date: Wed, Mar 20, 2002
Title rad50 coiled-coil zn hook
Authors J.A.TAINER, K.P.HOPFNER
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search HG HG binding statistics HG   search PO4 PO4 binding statistics PO4   search CIT CIT binding statistics CIT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MKKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTL
AKLIDRKSELERELRRIDMEIKRLTPLLTVAE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
member of: CATH:search1.10.287.510GENE3D:searchG3DSA_1.10.287.510HAMAP:searchMF_00449PANTHER:searchPTHR18937/searchPTHR18937_SF163PFAM:searchPF04423PROSITE PROFILES:searchPS51131, SUPERFAMILY:searchSSF75712UniProt:searchP58301
JMol viewer RasMol script viewer  PO4 301B  ..                                                                                                       
JMol viewer RasMol script viewer  CIT 507A  ..          *   *  *                                                                          *          
JMol viewer RasMol script viewer  PO4 306A  ..       *  |   |  |                                                                          |          
JMol viewer RasMol script viewer  PO4 305A  ..       |  |   |  |                 **  *                                                    |          
JMol viewer RasMol script viewer  PO4 304A  ..       |  |   |  |                 ||  |                    **  *                           |          
JMol viewer RasMol script viewer  PO4 303A  ..       |  |   |  |                 ||  |     *           *  *|  |                           |          
JMol viewer RasMol script viewer  HG 201A  ..       |  |   |  |                 ||  |     |  *  *     |  ||  |                           |          
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTLAKLIDRKSELERELRRIDMEIKRL
seq num:  ..396       406       416       426       436       446       456       466       476       486          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       |||||| |      | |        |   |  ||| ||      | |                  ^***          |  |          | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       ||**^* |      | |        |   |  ||| ||      | |                                |  |          **^
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |^**|  |      ^**        |   |  ||| ||      | |                                |  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |   ^***                 |   ^***|| ||      | |                                ^***             
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |   |                    |   |   ****|      | |                                                 
search RasMol script viewer Motif-ligand binding stats  nest ..       |   |                    |   |    |  |      ***                                                 
search RasMol script viewer Motif-ligand binding stats  niche ..       |   |                    |   |    ****                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..       *****                    *****                                                                  

chain B : DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
member of: CATH:search1.10.287.510GENE3D:searchG3DSA_1.10.287.510HAMAP:searchMF_00449PANTHER:searchPTHR18937/searchPTHR18937_SF163PFAM:searchPF04423PROSITE PROFILES:searchPS51131, SUPERFAMILY:searchSSF75712UniProt:searchP58301
JMol viewer RasMol script viewer  PO4 301B  ..                                                      *                                               
JMol viewer RasMol script viewer  HG 201A  ..                                                 *  * |                                               
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..MKKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTLAKLIDRKSELERELRRIDMEIK
seq num:  ..395       405       415       425       435       445       455       465       475       485         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         ||||| |  |   | |            |  ||| ||      | |                  ^***||        |  |      |  ||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |**^* |  |   | |            |  ||| ||      | |                   |  ||        |  |      |  |*
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ^**|| |  |   ^**            |  ||| ||      | |                   |  ||        |  |      |  ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  ^***  |   |              ^***|| ||      | |                   |  ||        ^***      |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |   |    |   |                  || ||      | |                   *****                  *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |   |    |   |                  ****|      | |                   ****                   **** 
search RasMol script viewer Motif-ligand binding stats  nest ..         |   |    |   |                   |  |      ***                                               
search RasMol script viewer Motif-ligand binding stats  niche ..         |   |    |   |                   ****                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..         *****    *****                                                                               

   New search    1l8d:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML