triangle PDBeMotif: 1l4w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification receptor, toxin    | release date: Wed, Mar 6, 2002
Title nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha- bungarotoxin
Authors A.O.SAMSON, E.RODRIGUEZ, J.ANGLISTER, M.EISENSTEIN, T.SCHERF
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Chain B sequence:
EERGWKHWVYYTCCPDTPYLDITEE
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALPHA-BUNGAROTOXIN
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP60615
sec str:  ...eeeee....eeeee......eeeeeeeee......eeeeeeeee..........eeeee..............
sequence :  ..IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
seq num:  ..1         11        21        31        41        51        61        71  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 |||||        | |^**      ||   | ^**      || ^** |  | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |||||        | |         ^*****          ||  || |  | |   
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..                 |||||        | |         *^***^**********^^***| |  | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |***|        | |                              | |  | |   
search RasMol script viewer Motif-ligand binding stats  nest ..                 | | |        ***                              ***  | |   
search RasMol script viewer Motif-ligand binding stats  niche ..                 *****                                              ***   

chain B : ACETYLCHOLINE RECEPTOR PROTEIN
member of: GENE3D:searchG3DSA_2.70.170.10PANTHER:searchPTHR18945/searchPTHR18945_SF74PFAM:searchPF02931SUPERFAMILY:searchSSF63712TIGRFAMS:searchTIGR00860UniProt:searchP02711
sec str:  ........eeeeee......eee....
sequence :  ..EERGWKHWVYYTCCPDTPYLDITEE
seq num:  ..180       190       200  

   New search    1l4w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML