triangle PDBeMotif: 1l3x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification protein binding    | release date: Fri, Mar 1, 2002
Title solution structure of novel disintegrin salmosin
Authors J.SHIN, W.LEE
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  .....................eee...eee..................eee............eee.........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||   |  ^**   || |||  ||  |  | |   ||  | ||   |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||   |        || |||  ||  |  | |   ||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****        ^*****  ||  |  | |   ||  | ||      ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |             | ||   ||  |  | |   ||  ***|                   
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |             | ^****^^**^********^*  |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****             ****          | |       ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..                                        ***                              

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ...eee.........................eee............eee.........eee.eee..........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  || ||   |  ^**   |  | |  ||  | |      ||  | ||   | |||| ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  || ||   |        |  | |  ||  | |      ||  *******^ |||| ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  || ^*****        ^*****  ||  | |      ||  | ||     |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..     |  ||  |               |    ||  | |      ||  ***|     | || |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..     |  ||  |               ^****^^**^********^*  |  |     | || |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |****                        | |          ****     | || |        
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                            ***                   | |***        
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                                  ***           

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ..eee.........................................eee.........eee.eee.......eee
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   ||||||  ||  |        ||  | || | | |||| ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        ||||||  ||  |        ||  *******^ |||| ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||  |        ||  | || |   |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                         |||||   ||  |        ||  ***| |   | || |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                         |||^****^^**^********^*  |  | |   | || |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |****                    **** |   | || |        
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |                         ***   | |***        
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                               ***           

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ......................................................................eee..
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   ||||||  ||| |||| |   ||  | |    | |||   |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        ||||||  ||| |||| |   ||  *******^ |||   |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||| |||| |   ||  | |      |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                         |||||   ||| |||| |   ||  ***      | |           
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                         |||^****^^**^********^*           | |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                         ||| |     *****| |                | |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         ||| |     ***| | |                | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |****     **** | |                | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ***                | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                               ***           

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ..............eee...........................eeeee...eee...eee..............
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**  ||| |||  ||  |  | |   ||  | |    |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |       ||| |||  ||  |  | |   ||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****       |^*****  ||  |  | |   ||  | |       ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                        | | ||   ||  |  | |   ||  ***                    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                        | | ^****^^**^********^*                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        | ****          | |                              
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***             ***                              

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ..............................................eeee........eee..............
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   ||||||  ||| |||      ||  | ||   | |||| ||| |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        ||||||  ||| |||      ||  *******^ |||| ||| |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||| |||      ||  | ||     |^*****| |    
search RasMol script viewer Motif-ligand binding stats  RGD ..                         |||||   ||| |||      ||  ***|     | || | | |    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                         |||^****^^**^********^*  |  |     | || | | |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                         ||| |     *****          |  |     | || | | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         ||| |     ***|           |  |     | || | | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |****     ****           ****     | || | | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |                               | |*** | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                               ***    ***    

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ..............................................eee.........eee.eee.....eee..
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||   |  ^**   |  | |  ||| |||| |   ||  ||||   | |||| ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||   |        |  | |  ||| |||| |   ||  *******^ |||| ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****        ^*****  ||| |||| |   ||  ||||     |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |               |    ||| |||| |   ||  ***|     | || |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |               ^****^^**^********^*   | |     | || |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |                      *****| |        | |     | || |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****                      **** | |        | |     | || |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                        ***        | |     | |***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                   ***     ***           

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ..............................................eee.........eee.eee..........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   |  | |  ||| |  | |   ||  | |    | |||| ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        |  | |  ||| |  | |   ||  *******^ |||| ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||| |  | |   ||  | |      |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                            |    ||| |  | |   ||  ***      | || |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                            ^****^^**^********^*           | || |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                   ***  | |                | || |        
search RasMol script viewer Motif-ligand binding stats  nest ..                                        ***                | |***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***           

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ....eee........eee..............................eee............eee.........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |   ||| ^**   ||||||  ||| |  | || |||  | || | |  |    || |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |   |||       ||||||  ||| |  | || |||  *******^  |    || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****|       ^*****  ||| |  | || |||  | || |    ^*****| |    
search RasMol script viewer Motif-ligand binding stats  RGD ..               | |       |||||   ||| |  | || |||  ***| |          | |    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..               | |       |||^****^^**^********^*     | |          | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..               | |       ||| |     ***  | || |       | |          | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | |       |****          | || |       | |          | |    
search RasMol script viewer Motif-ligand binding stats  nest ..               ***       | |            ******       ***          | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                                      ***    

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  .....................eee.......eee..................eee.....eeeeee....eee..
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   | || |  ||  |  | |   ||  | || | |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        | || |  ||  |  | |   ||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||  |  | |   ||  | || |    ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                         | ||    ||  |  | |   ||  ***| |                 
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                         | |^****^^**^********^*     | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ***          ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                                             

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ....eee.....................eee.............eee.....eee.................eee
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||   |  ^**   | || |  ||| |  | |   ||  | |    |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||   |        | || |  ||| |  | |   ||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****        ^*****  ||| |  | |   ||  | |       ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |            | ||    ||| |  | |   ||  ***                    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |            | |^****^^**^********^*                         
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |            | |       ***  | |                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****            | |            | |                              
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ***                              
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                                             

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ...eee.........eee...eee......................eeeee.....eeeee.eee..........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |   ||| ^**   |  | |  ||  |  | |   ||  | |    | |||   || |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |   |||       |  | |  ||  |  | |   ||  *******^ |||   || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****|       ^*****  ||  |  | |   ||  | |      |^*****| |    
search RasMol script viewer Motif-ligand binding stats  RGD ..               | |          |    ||  |  | |   ||  ***      | |    | |    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..               | |          ^****^^**^********^*           | |    | |    
search RasMol script viewer Motif-ligand binding stats  nest ..               ***                      ***                | |    | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***    ***    

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  .....................eee...................................................
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   ||||||  ||| |  | |   ||  | |    | |||   |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        ||||||  ||| |  | |   ||  *******^ |||   |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||| |  | |   ||  | |      |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                         |||||   ||| |  | |   ||  ***      | |           
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                         |||^****^^**^********^*           | |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         ||| |     ***  | |                | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |****          | |                | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ***                | |           
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                               ***           

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ....eee.......................................eeeee.......eee.eee..........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||   |  ^**  ||||| |  ||  |        ||  | ||   | |||| ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||   |       ||||| |  ||  |        ||  *******^ |||| ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****       |^*****  ||  |        ||  | ||     |^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |           |||||    ||  |        ||  ***|     | || |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |           ||||^****^^**^********^*  |  |     | || |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****           ||||                      ****     | || |        
search RasMol script viewer Motif-ligand binding stats  nest ..                        ****                               | |***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***           

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ....eee........................eee.............................eee.........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||  ||||^**   |  | |  ||| |        ||  | |    |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||  ||||      |  | |  ||| |        ||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****||      ^*****  ||| |        ||  | |       ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |  ||||         |    ||| |        ||  ***                    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |  ||||         ^****^^**^********^*                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****  ||||              | |                                     
search RasMol script viewer Motif-ligand binding stats  nest ..               ****              | |                                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ***                                     

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ....eee..............eee.......eeee.................eee........eee.........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||   |  ^**   | || |  ||  |  | || |||  | |    |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||   |        | || |  ||  |  | || |||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****        ^*****  ||  |  | || |||  | |       ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |            | ||    ||  |  | || |||  ***                    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |            | |^****^^**^********^*                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****            | |            | || |                           
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ******                           
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                                             

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  .....................eee...eee................................eee..........
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | ||   |  ^**  |||||||  ||  |  | |   ||  | ||   |  | | ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | ||   |       |||||||  ||  |  | |   ||  *******^  | | ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | ^*****       |^*****  ||  |  | |   ||  | ||      ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |           ||||||   ||  |  | |   ||  ***|        | |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..         |  |           ||||^****^^**^********^*  |  |        | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****           ||****          | |       ****        | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                        ****            ***                   ***        

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ...............................eee.............................eee......eee
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |    | ||   |  ^**   | || |  ||  |  | |   ||  | ||   |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |    | ||   |        | || |  ||  |  | |   ||  *******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |    | ^*****        ^*****  ||  |  | |   ||  | ||      ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD .. |  |    |  |            | ||    ||  |  | |   ||  ***|                   
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 .. |  |    |  |            | |^****^^**^********^*  |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****    ****            | |            | |       ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ***                              
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                                             

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  ...............eee...eee...................................................
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   ||||||  ||  |  | |   ||  | ||   |  | | ||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        ||||||  ||  |  | |   ||  *******^  | | ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||  |  | |   ||  | ||      ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                         |||||   ||  |  | |   ||  ***|        | |        
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                         |||^****^^**^********^*  |  |        | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |****          | |       ****        | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                         | |            ***                   ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                         ***                                             

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET AGGREGATION INHIBITOR DISINTEGRIN
member of: CATH:search4.10.70.10GENE3D:searchG3DSA_3.40.390.10/searchG3DSA_4.10.70.10PANTHER:searchPTHR11905/searchPTHR11905_SF22PFAM:searchPF00200PRINTS:searchDISINTEGRINPROSITE PATTERNS:searchPS00427, PROSITE PROFILES:searchPS50214, SMART:searchSM00050SUPERFAMILY:searchSSF57552UniProt:searchQ90WC0
sec str:  .....................eee........................eee.......eeee.............
sequence :  ..EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
seq num:  ..1         11        21        31        41        51        61        71 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |  ^**   || |||  ||  |        || || |    |  |    |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |    |        || |||  ||  |        || |*******^  |    |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****        ^*****  ||  |        || || |       ^*****       
search RasMol script viewer Motif-ligand binding stats  RGD ..                          | ||   ||  |        || |***                    
search RasMol script viewer Motif-ligand binding stats  DISINTEGRIN_1 ..                          | ^****^^**^********^* |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          ****                 | |                       
search RasMol script viewer Motif-ligand binding stats  niche ..                                               ***                       

   New search    1l3x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML