triangle PDBeMotif: 1l0z  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.36
Classification hydrolase    | release date: Thu, Feb 14, 2002
Title the structure of porcine pancreatic elastase complexed with bromide, cryoprotected with dry paraffin oil
Authors P.A.TUCKER, S.PANJIKAR
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search BR BR binding statistics BR   search XE XE binding statistics XE   search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ELASTASE 1
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24257/searchPTHR24257_SF0PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00772
JMol viewer RasMol script viewer  XE 261A  ..                                                                                                                                                                                       **  *                 * **                               
JMol viewer RasMol script viewer  BR 293A  ..                                                                                                                                                                                       ||  |                 | ||                     *  *      
JMol viewer RasMol script viewer  BR 292A  ..                                                                            ***                                                                                                        ||  |                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 291A  ..                                            *                               |||                                                                                                        |** *                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 290A  ..                                            |                               |||                                                             *                                          |** |                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 289A  ..         *                                  |                               |||                           *                                 |                                          ||| |                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 288A  ..         |                                  |                               |||         *                 |                                 |                        *  *              ||| |                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 287A  ..         |              **                  |                               |||         |                 |                                 |                        |  |              ||| |                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 286A  ..         |              ||                  |                          **   |||         |          **     |                                 |                        |  |              ||| |                 | ||                     |  |      
JMol viewer RasMol script viewer  BR 285A  ..         |              ||                  |                          ||   |||         |          ||     |         *                       |                        |  |              ||| |                 | ||                  * **  |      
JMol viewer RasMol script viewer  BR 284A  ..         |              ||                  |                 ***      ||   |||         |          ||     |         |                       |                        |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 283A  ..         |              ||**                |                 |||      ||   |||         |          ||     |         |                       |                        |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 282A  ..         |              ||||        **      |                 |||      ||   |||         |          ||*    |         |                       |                        |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 281A  ..         |              ||||        *|      |                 |||      ||   |||         |          ||| ** |         |                       |                        |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 280A  ..         |              ||||        ||      |                 *||      ||   |||         |          ||| || |         |                       | *                      |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 279A  ..         |              ||||        ||      |                 |||      ||   |||         |          ||| || |         |                       | |                * *   |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 278A  ..        *|              ||||        ||      |              ** |||      ||   |||         |          ||| || |         |                       | |*               | |   |  |              ||| |                 | ||                  | ||  |      
JMol viewer RasMol script viewer  BR 277A  ..        ||              ||||        ||      |              || |||      ||   |*|         |          ||| || |         |                       | ||               | |   |  |              ||| |                 | ||                  | ||  |     *
JMol viewer RasMol script viewer  BR 276A  ..        ||              ||||        ||      |              || |||      ||   |||         |          ||| ||**         |                       | ||               | |   |  |              ||| |                 | ||                  | ||  |     |
JMol viewer RasMol script viewer  BR 275A  ..        ||            * ||||        ||      |              || |||      ||   |||         |          ||| ||||         |                       | ||               | |   |  |              ||| |                 | ||                  | ||  |     |
JMol viewer RasMol script viewer  BR 274A  ..        ||            | ||||        ||      |              || |||      ||   |||         |          ||| ||||         |                       | ||               | |   |  |              ||| |                 | ||                  | |*  |*    |
JMol viewer RasMol script viewer  BR 273A  ..        ||            | ||||        ||      |              || |||      ||   |||         |          ||| ||||         |                       | ||               | |   |  |**            ||| |                 | ||               *  | ||  ||    |
JMol viewer RasMol script viewer  BR 272A  ..        ||            | ||||        ||      |              || |||      ||   |||         |          ||| ||||        **                       | ||               | |   |  |||            ||| |                 | ||               |  | *|  ||    |
JMol viewer RasMol script viewer  BR 271A  ..        ||            | ||||        ||      |              || |||      ||   |||         |          ||| ||||        ||                       |***               | |   |  |||            ||| |                 | ||               |  | ||  ||    |
JMol viewer RasMol script viewer  BR 270A  ..        ||            | ||||        ||      |              || |||      ||   |||         |          ||| ||||        ||                       ||||               | |   |  |||            ||| |      ****       | ||               |  | ||  ||    |
JMol viewer RasMol script viewer  BR 269A  ..        ||            | ||||        ||      |              || |||      ||  **||         |          ||| ||||        ||                       ||||               | |   |  |||            ||| |      ||||       | ||               |  | ||  ||    |
JMol viewer RasMol script viewer  BR 268A  ..        ||            | ||||        ||      |              || |||      ||  ||||         |          ||| ||||        ||                       ||||               | |   |  |**            ||| |      ||||       | ||               |  | ||  ||    |
JMol viewer RasMol script viewer  BR 267A  ..        ||            | ||||        ||      |              || |||      ||  ||||         |          ||| ||||       **|                       ||||               | |   |  |||            ||| |      |*||    *  | ||               |  | ||  ||    |
JMol viewer RasMol script viewer  BR 266A  ..        ||            | ||||        ||      |              || |||      ||  ||||         |          ||| ||||       |||  **                   ||||               | |   |  ||| *          ||| |      ||||    |  | ||               *  | ||  ||    |
JMol viewer RasMol script viewer  BR 265A  ..        ||            | ||||       **|      |              || |||      ||  ||||         |          ||| ||||   *   |||  ||                   ||||               | |   |  ||| |          ||| |      ||||    |  | ||               |  | ||  ||    |
JMol viewer RasMol script viewer  BR 264A  ..        ||            | ||||       |||      |              || |||      ||  ||||         |          ||| ||||   |   |||  ||                   ||||               | |   |  ||| |          ||| |      ||||    |  | ||       **      |  | ||  ||    |
JMol viewer RasMol script viewer  BR 263A  ..        ||            | ||||       |||      |              || |||      ||  ||||         |          ||| ||||   |   |||* ||                   ||||               | |   |  ||| |          ||| |      ||||    |  | ||       ||      *  * ||  ||    |
JMol viewer RasMol script viewer  BR 262A  ..        || ***        | ||||       |||      |              || |||      ||  ||||         |          ||| ||||   |   |||| ||                   ||||               | |   |  ||| |          ||| |    * ||||    |  | ||       ||      |  | ||  ||    |
JMol viewer RasMol script viewer  NA 260A  ..        || |||        | ||||       |||      |             *|* |*|*  *  ||  ||||         |          ||| ||||   |   |||| ||                   ||||               | |   |  ||| |          ||| |    | ||||    |  | ||       ||      |  | ||  ||    |
sec str:  ......ee........eeeeeeee..eeeeeeeeeeee..eeeehhhhhh....eeeee............eeeeeeeeee.......hhhhh...eeeee...........................eeeee..............eeee..eehhhhhh....hhhhh...eeee...............eeeeee..eeeeeeeeee............eeeee...hhhhhhhhhhhh
sequence :  ..VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||   |   |  |       |    |       |  | |   ||  |  | | |  | | |||||||     ||   |  |   || || |            | ||      | ||  || |     | |    |               || ||||   || |||  |    |||||| |||||||  |         ||  || | || ^***|||             |   | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| ||   |   |  |       |    |       |  | |   ||  |  | | |  | | |||||||     ||   |  |   || || |            | ||      | ||  || |     | |    |               || ||||   || |||  |    |||||| |||||||  |         ||  || | ||   |**^*             |   | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||   |   |  |       |    |       |  | |   ||  |  ^** |  | | |||||||     ||   |  |   || || |            | ||      | ||  || |     | |    |               || ||||   || ^**  |    |||||| |||||||  |         ||  || | ||   ^**               |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ^*****   |  |       ^*****       |  | |   ||  |      |  | | |||||||     ||   |  |   || || |            | ||      | ^***** |     | ^*****               || ||||   || |||  |    ||^*****||||||  |         ||  || | |^*****                |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..|  |       |  |                    |  | ****^*  |      |  | | |||||||     ||   |  |   || || |            | ||      |  |  |  |     | |                    || ||||   || |||  |    |||||| |||||||  |         ||  || | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..|  |       |  |                    |  |     ||  |      |  | | |||||||     ||   |  |   || || |            | ||      |  |  |  |     | |                    || ||||   || |||  |    |||||******^*****         ||  || | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |       |  |                    |  |     ||  |      |  | | |||||||     ||   |  |   || || |            | ||      |  |  |  |     | |                    *****||   || |||  |    |||||  |||||||            ||  || | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |       |  |                    |  |     ||  |      |  | ***|***||     ||   |  |   || || |            ***|      |  |  |  |     | |                     | | ||   || |||  |    |***|  |||||||            ||  || | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |       |  |                    |  |     ||  |      |  | |  | ||||     **   |  |   || || |            |  |      |  |  |  |     | |                     | | ||   || |||  |    |||||  |||||||            **  ** | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |       |  |                    ****     ||  |      |  | |  | ||||          ****   ***** |            |  |      ****  ****     | |                     | ****   ****||  |    |||||  *******                   | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..|  |       |  |                    |  |     ||  |      |  | |  | ****          |  |         |            |  |      |  |  |  |     | |                     | | ||    |  ||  |    *****  ||***||                   | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..****       ****                    ****     |****      **** ****  ***          ****         |            ****      ****  ****     ***                     | ****    ********           ||*****                   | |                      |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            |                                               |                                                             *****                        ||||||                    | |                      ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            |                                               |                                                                                          ||||||                    ***                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                            *                                               *                                                                                          ******                                                   

   New search    1l0z:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors