triangle PDBeMotif: 1kwa  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification kinase    | release date: Fri, Jan 16, 1998
Title human cask/lin-2 pdz domain
Authors A.R.COHEN, A.T.BRUNGER, D.L.DANIELS, J.M.ANDERSON
Method X-RAY DIFFRACTION (resolution: 1.93Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
RSRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFK
IVPSYREF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 704A  ..                                                                                    *   
JMol viewer RasMol script viewer  SO4 703A  ..             *                                                        *             |   
sec str:  ....eeeeeee.......eeee...hhh.eeeee....hhhhh.......eeeee....hhh..hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497       507       517       527       537       547       557       567     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || |  |  |   || |  |    |||||  |  ||| || | ^***  |   |  |    | |  ||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^**  |  |   || |  |    |||||  |  ||| || | |||   |   |  |    ^**  |^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |     |  |   || |  |    |||||  |  ||| || | |||   |   |  |         |^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |     |  |   || |  |    |||||  |  ||| ^*****||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |     |  |   ** |  |    |||||  |  **|  | |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |     ****      |  |    |||||  |    **** |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***               |  |    ****|  |         |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                   ****        ****         ****|   |   ****         ***   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                             *****                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 702B  ..                     ..                     **                                          
sec str:  ....eeeeeee.......eeee.......eeeee....hhhhh.......eeeee.........hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKM..LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497        ..510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || | ..      || |  |    |||||  |  ||| ||  |^***      |  |    | | | | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^** ..      || |  |    |||||  |  ||| ||  |||        |  |    ^** | ^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |    ..      || |  |    |||||  |  ||| ||  |||        |  |        | ^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |    ..      || |  |    |||||  |  ||| ^*****|        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |    ..      ** |  |    |||||  |  **|  |  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |    ..         ****    ||||****    ****  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | | | |    ..         |  |    |||||  |          ***        |  |        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***    ..         |  |    ****|  |                     |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..          ***        ..         ****        ****                     ****               
search RasMol script viewer Motif-ligand binding stats  stturn ..          ***        ..                                                                 

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 702B  ..                                                                      *                 
JMol viewer RasMol script viewer  SO4 704A  ..                              *                                       |             *   
JMol viewer RasMol script viewer  SO4 703A  ..             *                |                                       *             |   
sec str:  ....eeeeeee.......eeee...hhh.eeeee....hhhhh.......eeeee....hhh..hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497       507       517       527       537       547       557       567     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || |  |  |   || |  |    |||||  |  ||| || | ^***  |   |  |    | |  ||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^**  |  |   || |  |    |||||  |  ||| || | |||   |   |  |    ^**  |^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |     |  |   || |  |    |||||  |  ||| || | |||   |   |  |         |^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |     |  |   || |  |    |||||  |  ||| ^*****||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |     |  |   ** |  |    |||||  |  **|  | |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |     ****      |  |    |||||  |    **** |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***               |  |    ****|  |         |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                   ****        ****         ****|   |   ****         ***   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                             *****                      

chain B : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 702B  ..                     ..                     **                                          
JMol viewer RasMol script viewer  SO4 704A  ..                   * ..       *             ||                                          
JMol viewer RasMol script viewer  SO4 703A  ..                   | ..       |             ||                                        * 
sec str:  ....eeeeeee.......eeee.......eeeee....hhhhh.......eeeee.........hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKM..LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497        ..510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || | ..      || |  |    |||||  |  ||| ||  |^***      |  |    | | | | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^** ..      || |  |    |||||  |  ||| ||  |||        |  |    ^** | ^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |    ..      || |  |    |||||  |  ||| ||  |||        |  |        | ^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |    ..      || |  |    |||||  |  ||| ^*****|        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |    ..      ** |  |    |||||  |  **|  |  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |    ..         ****    ||||****    ****  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | | | |    ..         |  |    |||||  |          ***        |  |        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***    ..         |  |    ****|  |                     |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..          ***        ..         ****        ****                     ****               
search RasMol script viewer Motif-ligand binding stats  stturn ..          ***        ..                                                                 

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 702B  ..                                                                      *                 
JMol viewer RasMol script viewer  SO4 704A  ..                                                                      |             *   
JMol viewer RasMol script viewer  SO4 703A  ..             *                                                        *             |   
sec str:  ....eeeeeee.......eeee...hhh.eeeee....hhhhh.......eeeee....hhh..hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497       507       517       527       537       547       557       567     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || |  |  |   || |  |    |||||  |  ||| || | ^***  |   |  |    | |  ||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^**  |  |   || |  |    |||||  |  ||| || | |||   |   |  |    ^**  |^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |     |  |   || |  |    |||||  |  ||| || | |||   |   |  |         |^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |     |  |   || |  |    |||||  |  ||| ^*****||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |     |  |   ** |  |    |||||  |  **|  | |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |     ****      |  |    |||||  |    **** |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***               |  |    ****|  |         |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                   ****        ****         ****|   |   ****         ***   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                             *****                      

chain B : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 702B  ..                     ..                     **                                          
JMol viewer RasMol script viewer  SO4 703A  ..                     ..                     ||                                        * 
sec str:  ....eeeeeee.......eeee.......eeeee....hhhhh.......eeeee.........hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKM..LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497        ..510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || | ..      || |  |    |||||  |  ||| ||  |^***      |  |    | | | | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^** ..      || |  |    |||||  |  ||| ||  |||        |  |    ^** | ^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |    ..      || |  |    |||||  |  ||| ||  |||        |  |        | ^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |    ..      || |  |    |||||  |  ||| ^*****|        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |    ..      ** |  |    |||||  |  **|  |  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |    ..         ****    ||||****    ****  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | | | |    ..         |  |    |||||  |          ***        |  |        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***    ..         |  |    ****|  |                     |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..          ***        ..         ****        ****                     ****               
search RasMol script viewer Motif-ligand binding stats  stturn ..          ***        ..                                                                 

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 704A  ..                                                                                    *   
JMol viewer RasMol script viewer  SO4 703A  ..             *                                                        *             |   
sec str:  ....eeeeeee.......eeee...hhh.eeeee....hhhhh.......eeeee....hhh..hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497       507       517       527       537       547       557       567     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || |  |  |   || |  |    |||||  |  ||| || | ^***  |   |  |    | |  ||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^**  |  |   || |  |    |||||  |  ||| || | |||   |   |  |    ^**  |^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |     |  |   || |  |    |||||  |  ||| || | |||   |   |  |         |^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |     |  |   || |  |    |||||  |  ||| ^*****||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |     |  |   ** |  |    |||||  |  **|  | |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |     ****      |  |    |||||  |    **** |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***               |  |    ****|  |         |  ||   |   |  |         | |   
search RasMol script viewer Motif-ligand binding stats  niche ..          ***                   ****        ****         ****|   |   ****         ***   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                             *****                      

chain B : HCASK/LIN-2 PROTEIN
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_2.30.42.10PANTHER:searchPTHR23122/searchPTHR23122_SF40PFAM:searchPF00595PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchO14936
JMol viewer RasMol script viewer  SO4 702B  ..                     ..                     **                                          
JMol viewer RasMol script viewer  SO4 704A  ..                   * ..       *             ||                                          
sec str:  ....eeeeeee.......eeee.......eeeee....hhhhh.......eeeee.........hhhhhhhhhh..eeeeeeee......
sequence :  ..RSRLVQFQKNTDEPMGITLKM..LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF
seq num:  ..487       497        ..510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | | || | ..      || |  |    |||||  |  ||| ||  |^***      |  |    | | | | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | | |^** ..      || |  |    |||||  |  ||| ||  |||        |  |    ^** | ^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | | |    ..      || |  |    |||||  |  ||| ||  |||        |  |        | ^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | | |    ..      || |  |    |||||  |  ||| ^*****|        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | | | |    ..      ** |  |    |||||  |  **|  |  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | | |    ..         ****    ||||****    ****  | |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | | | |    ..         |  |    |||||  |          ***        |  |        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ***    ..         |  |    ****|  |                     |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..          ***        ..         ****        ****                     ****               
search RasMol script viewer Motif-ligand binding stats  stturn ..          ***        ..                                                                 

   New search    1kwa:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors