triangle PDBeMotif: 1kt8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.6.1.42
Classification transferase    | release date: Tue, Jan 15, 2002
Title human branched chain amino acid aminotransferase (mitochondr three dimensional structure of enzyme in its ketimine form substrate l-isoleucine
Authors G.K.FARBER, H.P.YENNAWAR, M.E.CONWAY, N.H.YENNAWAR, S.M.HUTSON
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search ILP ILP binding statistics ILP   search ACY ACY binding statistics ACY   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE, MITOC
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF2PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchO15382
JMol viewer RasMol script viewer  GOL 2001B  ..                                                                                                                                                                             ..GOL ..                                                                                                                                                                                           
JMol viewer RasMol script viewer  ILP 900B  ..                                                                     *                                                                                    *                  ..ILP ..                                                                                                                                                                                           
JMol viewer RasMol script viewer  ACY 1005A  ..                                                                     |                     * *                                                            |                  ..ACY ..                                                                                                                                                                                      *    
JMol viewer RasMol script viewer  ACY 1004A  ..                                                                     |                     | *                                                            |                  ..ACY ..                                                                                                                                                                                      |    
JMol viewer RasMol script viewer  ACY 1003A  ..                                                                     |                     | |       *                                                    |                  ..ACY ..                     *                                                            *     *                                                                                             |    
JMol viewer RasMol script viewer  ILP 400A  ..                                                                     |    * *              | |    *  |                                      *             |                  ..ILP ..             *       | *    *                             *  ***                  |    *|***                                         **                                               |    
sec str:  .......hhhhhee........................eeeeeeee..ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee............eeeeeeeeee...... .....eeeee................hhhhhhhhhhhhhhhhhh...eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeee.....eeeeeeeee..eeee.hhhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRALLFVILCPVGAY... ..VTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161          ... ..179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | | || ||    | |             | |  |       |  |          ^***|  |  ||| |          | |||                   | |   |   |           |  |  |  |         |   |||                   ..PS00001..        |  |   | |||  || |  |  |       | |||         | |  |          |  | |        | | |  | | |  |   |||||       | | |  || ||||||  | |  |                               |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ^**| ||    ^**             | |  |       |  |              |  |  ||| |          | |||                   | |   |   |           |  |  |  |         |   |||                   ..PS00005..        |  |   | |||  || |  |  |       | |||         | |  |          |  | |        | | |  | | |  |   |||||       ^** |  || ||||||  | |  |                               |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | | || ||    | |             | ^***       |  |              |  |  ||| |          | |||                   | |   |   |           |  |  |  |         |   |||                   ..PS00006..        |  |   | |||  || |  |  |       | |||         | |  |          ^*** |        | | |  | | ^***   ^***|       |   |  || ||||||  | |  |                               |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | | || ||    | |             | |          |  |              |  |  ||| |          | |||                   | |   |   |           |  |  |  |         |   |||                   ..PS00007..        |  |   | |||  || |  |  |       | |||         | |  |             | |        | | |  | | |       ||||       |   |  || ||||||  | |  |                               *******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | | || ||    | |             | |          |  |              |  |  ||| |          | |||                   | |   |   |           |  |  |  |         ^*****|                   ..PS00008..        |  |   | ^*****| |  |  |       | |||         | |  |             | |        | | |  | | |       ||||       |   |  || ||||||  ^*****                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 .. | | || ||    | |             | |          |  |              |  |  ||| |          | |||                   | |   |   |           |  |  |  |             | |                   ..PS00770..        |  |   |  ||  || |  |  |       | |||         | |  *********************************** |       ||||       |   |  || ||||||    |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | || ||    | |             | |          |  |              |  *****| |          | |||                   | |   |   |           |  |  |  |             | |                   ..alphabetamotif..        |  |   |  ||  || |  |  |       | |||         | |  |             | |        | | |  |   |       ||||       |   |  || ||||||    |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | | || ||    | |             | |          |  |              |  |  | | |          | |||                   | |   *****           |  |  |  |             | |                   ..asxmotif..        |  |   |  ||  || |  |  |       | |||         | |  |             | |        | | |  |   |       ||||       |   |  || ||||||    |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. | | || ||    | |             | |          |  |              |  |  | | |          | ***                   | |                   |  |  |  |             | |                   ..asxturn..        |  |   |  ||  || |  |  |       | |||         | |  |             | |        | | |  |   |       ||||       |   |  || ||||||    |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge .. | | || ||    | |             | |          |  |              |  |  | | |          | |||                   | |                   |  |  |  |             | |                   ..betabulge..        |  |   |  ||  || |  |  |       | |||         | |  |             | |        | | |  |   |       ||||       |   |  || ||||**    |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | | || ||    | |             | |          |  |              |  |  | | |          *****                   | |                   |  |  |  |             | |                   ..betabulgeloop..        |  |   |  ||  || |  |  |       | |||         | |  |             | |        | | |  |   |       ||||       |   |  || ||||      |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn .. | | *****    | |             | |          ****              ******* | |          ****|                   | |                   ****  ****             | |                   ..betaturn..        |  |   ****|  || *******       ****|         | |  |             | |        | | |  |   |       ||||       |   |  |****||      |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***  |  |    | |             | |                            |  |    | |            | |                   | |                   |  |  |  |             | |                   ..gammaturn..        |  |       |  ||                 | |         ***  |             | |        | | |  |   |       ||||       |   |  |  ||||      |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |             ***                            |  |    ***            ***                   ***                   |  |  |  |             | |                   ..nest..        |  |       |  ||                 ***              |             ***        *** |  |   |       ****       |   |  |  ****      |  |                                      **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    | |                                            ****                                                               ****  ****             ***                   ..niche..        ****       ****|                                  |                            |  |   |                  |   |  |   ***      ****                                           ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              | |                                                                                                                                      | |                   ..schellmannloop..                       |                                  |                            |  |   |                  |   |  ******                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..              | |                                                                                                                                      | |                   ..stmotif..                       |                                  |                            |  |   |                  *****                                                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..              | |                                                                                                                                      | |                   ..ststaple..                       |                                  |                            |  *****                                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                                                                                                                                      ***                   ..stturn..                       |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                             ..REP00000..                       *                                  *                            *                                                                                                   

chain B : BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE, MITOC
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF2PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchO15382
JMol viewer RasMol script viewer  GOL 2001B  ..                                                                                                                                                                                             *                     **                                                                                                                                                        
JMol viewer RasMol script viewer  ACY 1006B  ..                                                                                           * **                                                                                              |                     ||                                                                                                                                                        
JMol viewer RasMol script viewer  ACY 1002B  ..                                                                                           | ||                                                                                              |                     ||                                                              **  *                                                                              * *    
JMol viewer RasMol script viewer  ACY 1001B  ..                                       * *                 *                               | ||                                                                  *                           |                     ||                                                              ||  |                                                                              | |    
JMol viewer RasMol script viewer  ILP 900B  ..                                       | |                 |              * *              | ||   *                                         * *                  |                           | *         *    *    ||                       *  ***                       * ***     ||  |                               **                                             | |    
sec str:  .......hhhhh..........................eeeeeeee..ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee............eeeeeeeeee...........eeee.................hhhhhhhhhhhhhhhhhh...eeeeee....eeeee...eeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeee.....eeeeeeee....eee.hhhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
seq num:  ..501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | ||  |    | |             | |  |       | |||         ^***|  |    | |                                  | |   |   |          || ||  |  |         |   |||                 | |  | |       | ||   | |||  || |  |  |       | |||      || |||  |          |  | |        ||||| |  | |  |   |||||       | | |     ||||||  | |  |                   |  |        |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**|  |    ^**             | |  |       | |||             |  |    | |                                  | |   |   |          || ||  |  |         |   |||                 | |  | |       | ||   | |||  || |  |  |       | |||      || |||  |          |  | |        ||||| |  | |  |   |||||       ^** |     ||||||  | |  |                   |  |        |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |    | |             | ^***       | |||             |  |    | |                                  | |   |   |          || ||  |  |         |   |||                 | |  | |       | ||   | |||  || |  |  |       | |||      || |||  |          ^*** |        ||||| |  | ^***   ^***|       |   |     ||||||  | |  |                   |  |        |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |    | |             | |          | |||             |  |    | |                                  | |   |   |          || ||  |  |         |   |||                 | |  | |       | ||   | |||  || |  |  |       | |||      || |||  |             | |        ||||| |  |         ||||       |   |     ||||||  | |  |                   |  |        *******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |    | |             | |          | |||             |  |    | |                                  | |   |   |          || ||  |  |         ^*****|                 | |  | |       | ||   | ^*****| |  |  |       | |||      || |||  |             | |        ||||| |  |         ||||       |   |     ||||||  ^*****                   |  |               |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..      |  |    | |             | |          | |||             |  |    | |                                  | |   |   |          || ||  |  |             | |                 | |  | |       | ||   |  ||  || |  |  |       | |||      || |||  ***********************************         ||||       |   |     ||||||    |  |                   |  |               |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |    | |             | |          *****             |  |    | |                                  | |   *****          || ||  |  |             | |                 | |  | |       | ||   |  ||  || |  |  |       | |||      || |||  |             | |        ||||| |            ||||       |   |     ||||||    |  |                   |  |               |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |    | |             | |          ***|              |  |    | |                                  | |                  || ||  |  |             | |                 | |  | |       ***|   |  ||  || |  |  |       | |||      || |||  |             | |        ***|| |            ||||       |   |     ||||||    |  |                   |  |               |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  |    | |             | |          |  |              |  |    | |                                  | |                  || ||  |  |             | |                 | |  | |       |  |   |  ||  || |  |  |       | |||      || |||  |             | |        ||||| |            ||||       |   |     ||||**    |  |                   |  |               |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |    | |             | |          ****              |  |    | |                                  | |                  *****  |  |             | |                 | |  | |       |  |   ****|  || *******       ****|      |****|  |             | |        ||||| |            ||||       |   |     ||||      |  |                   ****               |||| |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |    | |             | |                            |  |    | |                                  | |                   |  |  |  |             | |                 | |  | |       |  |       |  ||                 | |      |  | |  |             | |        ||||***            ||||       |   |     ||||      |  |                                      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |             ***                            |  |    ***                                  ***                   |  |  |  |             | |                 | |  ***       |  |       |  ||                 ***      |  ***  |             ***        ****|              ****       |   |     ****      |  |                                      **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    | |                                            ****                                                               ****  ****             ***                 ***            ****       ****|                          |    |  |                         ***|                         |   |      ***      ****                                           ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              | |                                                                                                                                      | |                                               |                          ******  |                            |                         |   |                                                                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..              | |                                                                                                                                      | |                                               |                                  |                            |                         *****                                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                                                                                                                                      ***                                               |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                         *                                  *                            *                                                                                                   

   New search    1kt8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors