triangle PDBeMotif: 1kmf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification hormone/growth factor    | release date: Fri, Dec 14, 2001
Title nmr structure of human insulin mutant ile-a2-allo-ile, his- b10-asp, pro-b28-lys, lys-b29-pro, 15 structures
Authors B.XU, M.A.WEISS, P.G.KATSOYANNIS, Q.X.HUA, S.H.NAKAGAWA, W.JIA, Y.C.CHU
Method SOLUTION NMR
PDBe Citation   
Modified residues:  search IIL IIL binding statistics IIL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GIVEQCCTSICSLYQLENYCN
Chain B sequence:
FVNQHLCGSDLVEALYLVCGERGFFYTKPT
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***** ***** |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****  ****| |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  ***         

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 .. |  |^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****       |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        ****    

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***********           
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **** *****            

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 .. |  |^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****       |  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        ******* 

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |         ******           
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |         *****            
search RasMol script viewer Motif-ligand binding stats  niche .. ***                          

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 .. |  |^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****        |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****         ****   

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***** ***** |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****  ****| |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  ***         

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 .. |  |^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****                

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         **********| | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..         **** **** | | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   *** |      
search RasMol script viewer Motif-ligand binding stats  nest ..                     ***      
search RasMol script viewer Motif-ligand binding stats  niche ..                     ***      

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****    

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****|*****           
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **********            

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            *****    

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***********           
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **** *****            

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ******  

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |          *****           
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |          ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***                          

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****    

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ***** ****** |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****  *****| |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  ***         

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              ***** |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****| |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  ***         

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 .. |  |^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****                

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              ***** |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****| |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  ***         

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 .. |  |^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****      || ||    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****       *****    

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              ***** |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****| |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  ***         

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***********           
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **********            

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..  |  ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****               

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              *****           
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****            

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN
sec str:  ...hhhhhh....hhhhhhhhh.
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  PS00262 ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..               ****  

chain B : INSULIN
sec str:  ..........hhhhhhhhhhh...........
sequence :  ..FVNQHLCGSDLVEALYLVCGERGFFYTKPT
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |    ***** *****           
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |    ****  ****            
search RasMol script viewer Motif-ligand binding stats  niche ..****                          

   New search    1kmf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML