triangle PDBeMotif: 1kld  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification growth factor    | release date: Tue, Jan 16, 1996
Title solution structure of tgf-b1, nmr, models 18-33 of 33 struct
Authors A.B.ROBERTS, A.P.HINCK, B.-L.ZHANG, D.A.TORCHIA, J.A.WEAT, J.WENKER, M.B.SPORN, M.L.-S.TSANG, R.LUCAS, S.J.ARCHER, S.W.QIAN
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     | |   | || |||   |    |   |     | |         |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     | |   | || |||   |    |   |     | |         |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     | |   | |********^    |   |     | |         |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     | |   | |  |||        |   |     | |         |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     | |   | |  ***********^***^     | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||                  | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**                  | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                    | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                    | |         |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                    ***         *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     | |   | || |||   |    |   |     | |         |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     | |   | || |||   |    |   |     | |         |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     | |   | |********^    |   |     | |         |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     | |   | |  |||        |   |     | |         |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     | |   | |  ***********^***^     | |         |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||                  | |         |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**                  | |         |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                    | |         |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                    | |         |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                    ***         *******                                        

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   |    |   |  | |   |  ||    |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   |    |   |  | |   |  ||    |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^    |   |  | |   |  ||    |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||        |   |  | |   |  ||    |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^  | |   |  ||    |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |      | |     | |   | |  |||               | |   *****    |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||               | |   |  |     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||               | |   |  |     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |   |  |     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |   ****     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   |    |   |  | |   |  ||    |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   |    |   |  | |   |  ||    |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^    |   |  | |   |  ||    |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||        |   |  | |   |  ||    |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^  | |   |  ||    |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |      | |     | |   | |  |||               | |   *****    |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||               | |   |  |     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||               | |   |  |     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |   |  |     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |   ****     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     | |   | |********^    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     | |   | |  |||        |   |  | |  |  |      |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     | |   | |  ***********^***^  | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |  ****      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     | |   | |********^    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     | |   | |  |||        |   |  | |  |  |      |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     | |   | |  ***********^***^  | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |  ****      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 21     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     |||  || || |||   |    |   |  | |   |  || |  || |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     |||  || || |||   |    |   |  | |   |  || |  || |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     |||  || |********^    |   |  | |   |  || |  || |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     |||  || |  |||        |   |  | |   |  || |  || |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     |||  || |  ***********^***^  | |   |  || |  || |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |      | |     |||  || |  |||               | |   ***** ***** |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     |*****| |  |||               | |   |  |  |  |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |   |  |  |  |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |   ****  ****  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     |||  || || |||   |    |   |  | |   |  || |  || |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     |||  || || |||   |    |   |  | |   |  || |  || |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     |||  || |********^    |   |  | |   |  || |  || |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     |||  || |  |||        |   |  | |   |  || |  || |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     |||  || |  ***********^***^  | |   |  || |  || |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |      | |     |||  || |  |||               | |   ***** ***** |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     |*****| |  |||               | |   |  |  |  |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |   |  |  |  |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |   ****  ****  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 22     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  || | ^**        | |   | || |||   |    |   ||  | | || |||    |  |  |  |                | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  || ^***         | |   | || |||   |    |   ||  | | || |||    |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  ||              | |   | |********^    |   ||  | | || |||    |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  ||              | |   | |  |||        |   ||  | | || |||    |  |  |  |                ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |  ||              | |   | |  ***********^***^|  | | || |||    |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****              | |   | |  |||             |  | | |*****    |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****              | |   | |  |||             |  | | || ||     |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |               | |   | |  |**             |  | | || ||     |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****               | |   | |  |               |  | | *****     |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |               |  *** |         |  |  |  |                ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |               |  | | |         |  |  |  |                           ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****               **** ***         **********                                     

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  || | ^**        | |   | || |||   |    |   ||  | | || |||    |  |  |  |                | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  || ^***         | |   | || |||   |    |   ||  | | || |||    |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  ||              | |   | |********^    |   ||  | | || |||    |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  ||              | |   | |  |||        |   ||  | | || |||    |  |  |  |                ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |  ||              | |   | |  ***********^***^|  | | || |||    |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****              | |   | |  |||             |  | | |*****    |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****              | |   | |  |||             |  | | || ||     |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |               | |   | |  |**             |  | | || ||     |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****               | |   | |  |               |  | | *****     |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |               |  *** |         |  |  |  |                ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |               |  | | |         |  |  |  |                           ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****               **** ***         **********                                     

Assembly 1  model: 23     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   |    |   |   | |  |  ||    |  |  |                   |  |       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   |    |   |   | |  |  ||    |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^    |   |   | |  |  ||    |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||        |   |   | |  |  ||    |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^   | |  |  ||    |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |      | |     | |   | |  |||                | |  *****    |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||                | |  |  |     |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||                | |  |  |     |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**                | |  |  |     |  |  |                              |**       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                  | |  ****     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                  ***           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   |    |   |   | |  |  ||    |  |  |                   |  |       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   |    |   |   | |  |  ||    |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^    |   |   | |  |  ||    |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||        |   |   | |  |  ||    |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^   | |  |  ||    |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |      | |     | |   | |  |||                | |  *****    |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||                | |  |  |     |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||                | |  |  |     |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**                | |  |  |     |  |  |                              |**       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                  | |  ****     |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                  ***           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 24     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**        | |   | || |||   |    |   |     | ||  ||  | ||||  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^***         | |   | || |||   |    |   |     | ||  ||  | ||||  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |              | |   | |********^    |   |     | ||  ||  | ||||  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |              | |   | |  |||        |   |     | ||  ||  | ||||  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |              | |   | |  ***********^***^     | ||  ||  | ||||  |                              | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |              | |   | |  |||                  | |*****  *****|  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****              | |   | |  |||                  | ||  |   | || |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***                | |   | |  |||                  | ||  |   | || |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |   | |  |**                  | ||  |   | || |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |   | |  |                    | |****   **** |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |                    | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                    | |         |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                    ***         *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**        | |   | || |||   |    |   |     | ||  |   | ||||  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^***         | |   | || |||   |    |   |     | ||  |   | ||||  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |              | |   | |********^    |   |     | ||  |   | ||||  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |              | |   | |  |||        |   |     | ||  |   | ||||  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |              | |   | |  ***********^***^     | ||  |   | ||||  |                              | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |              | |   | |  |||                  | ||  |   *****|  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****              | |   | |  |||                  | ||  |   | || |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***                | |   | |  |||                  | ||  |   | || |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |   | |  |**                  | ||  |   | || |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |   | |  |                    | |****   **** |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |                    | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                    | |         |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                    ***         *******                                        

Assembly 1  model: 25     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   | |  || ||  | |  | |       |  |  |  |                | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   | |  || ||  | |  | |       |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^ |  || ||  | |  | |       |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||   | |  || ||  | |  | |       |  |  |  |                ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^  | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||   | |   | |   | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||   | |   | |   | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**   | |   | |   | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |     ***   | |   ***  | |       |  |  |  |                ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |           | |        | |       |  |  |  |                           ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****           ***        | |       **********                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                       ***                                                      

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   | |  || ||  | |  | |       |  |  |  |                | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   | |  || ||  | |  | |       |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^ |  || ||  | |  | |       |  |  |  |                | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||   | |  || ||  | |  | |       |  |  |  |                ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^  | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||   | |   | |   | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||   | |   | |   | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**   | |   | |   | |  | |       |  |  |  |                | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |     ***   | |   ***  | |       |  |  |  |                ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |           | |        | |       |  |  |  |                           ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****           ***        | |       **********                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                       ***                                                      

Assembly 1  model: 26     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     | |   | |********^    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     | |   | |  |||        |   |  | |  |  |      |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     | |   | |  ***********^***^  | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |  ****      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**| |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^*** | |     | |   | || |||   |    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             | |     | |   | |********^    |   |  | |  |  |      |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..             | |     | |   | |  |||        |   |  | |  |  |      |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..             | |     | |   | |  ***********^***^  | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**               | |  |  |      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |                 | |  ****      |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                 ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 27     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   |    |   |     | |         |  |  |                   |  |       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   |    |   |     | |         |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^    |   |     | |         |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||        |   |     | |         |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^     | |         |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||                  | |         |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||                  | |         |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**                  | |         |  |  |                              |**       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                    | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                    | |         |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                    ***         *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   |    |   |     | | |       |  |  |                   |  |       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   |    |   |     | | |       |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^    |   |     | | |       |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||        |   |     | | |       |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^     | | |       |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||                  | | |       |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||                  | | |       |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**                  | | |       |  |  |                              |**       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |                    | | |       |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                    | | |       |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                    *** |       *******                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                       ***                                                      

Assembly 1  model: 28     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**| |     | |   | || |||   |    |   ||  | | | |       |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^*** | |     | |   | || |||   |    |   ||  | | | |       |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             | |     | |   | |********^    |   ||  | | | |       |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..             | |     | |   | |  |||        |   ||  | | | |       |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..             | |     | |   | |  ***********^***^|  | | | |       |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**             |  | | | |       |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |               |  *** | |       |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |               |  | | | |       |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****               **** *** |       *******                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                       ***                                                      

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   | | ^**| |     | |   | || |||   |    |   ||  | | |         |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   | ^*** | |     | |   | || |||   |    |   ||  | | |         |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   |      | |     | |   | |********^    |   ||  | | |         |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   |      | |     | |   | |  |||        |   ||  | | |         |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  |   |      | |     | |   | |  ***********^***^|  | | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||             |  | | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**             |  | | |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |               |  *** |         |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |               |  | | |         |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****               **** ***         *******                                        

Assembly 1  model: 29     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**              | || |||   |    |   |                 |  |  |                   | ||       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***               | || |||   |    |   |                 |  |  |                   | ||       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                           | |********^    |   |                 |  |  |                   | ||       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                           | |  |||        |   |                 |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..                           | |  ***********^***^                 |  |  |                   | |        |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                           | |  |**                              |  |  |                   | |        |**       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           | |  |                                |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**              | || |||   |    |   |                 |  |  |                   | ||       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***               | || |||   |    |   |                 |  |  |                   | ||       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                           | |********^    |   |                 |  |  |                   | ||       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                           | |  |||        |   |                 |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..                           | |  ***********^***^                 |  |  |                   | |        |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                           | |  |**                              |  |  |                   | |        |**       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           | |  |                                |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 30     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**        | |   | || |||   |    |   |  | |  | |       |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***         | |   | || |||   |    |   |  | |  | |       |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                     | |   | |********^    |   |  | |  | |       |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                     | |   | |  |||        |   |  | |  | |       |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..                     | |   | |  ***********^***^  | |  | |       |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |   | |  |**               | |  | |       |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |                 ***  | |       |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                      | |       |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                      | |       *******                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                       ***                                                      

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**        | |   | || |||   |    |   |  | |  | |       |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***         | |   | || |||   |    |   |  | |  | |       |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                     | |   | |********^    |   |  | |  | |       |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                     | |   | |  |||        |   |  | |  | |       |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..                     | |   | |  ***********^***^  | |  | |       |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |   | |  |**               | |  | |       |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |                 ***  | |       |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                      | |       |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                      | |       *******                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                       ***                                                      

Assembly 1  model: 31     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   | |  |   | | | | |  |      |  |  |                   |  |       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   | |  |   | | | | |  |      |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^ |  |   | | | | |  |      |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||   | |  |   | | | | |  |      |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^ | | | |  |      |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||   | |        | | | |  |      |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||   | |        | | | |  |      |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**   | |        | | | |  |      |  |  |                              |**       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |     | |        | | | ****      |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |     ***        | ***           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                | |             |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                ***             *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**| |     | |   | || |||   | |  |   | | | | |  |      |  |  |                   |  |       |||  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^*** | |     | |   | || |||   | |  |   | | | | |  |      |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |      | |     | |   | |********^ |  |   | | | | |  |      |  |  |                   |  |       |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | |      | |     | |   | |  |||   | |  |   | | | | |  |      |  |  |                   ^***       |||       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | |      | |     | |   | |  ***********^***^ | | | |  |      |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  *****      | |     | |   | |  |||   | |        | | | |  |      |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***        | |     | |   | |  |||   | |        | | | |  |      |  |  |                              |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |     | |   | |  |**   | |        | | | |  |      |  |  |                              |**       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |     | |   | |  |     | |        | | | ****      |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***     ***   | |  |     ***        | ***           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                | |             |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                ***             *******                                        

Assembly 1  model: 32     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**        |||  || || |||   | |  |   |  | |   |  ||    |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***         |||  || || |||   | |  |   |  | |   |  ||    |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                     |||  || |********^ |  |   |  | |   |  ||    |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                     |||  || |  |||   | |  |   |  | |   |  ||    |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..                     |||  || |  ***********^***^  | |   |  ||    |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |||  || |  |||   | |         | |   *****    |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                     |*****| |  |||   | |         | |   |  |     |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |   | |  |**   | |         | |   |  |     |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |   | |  |     | |         | |   ****     |  ****                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |     ***         ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ^**        |||  || || |||   | |  |   |  | |   |  ||    |  |  |                   | ||       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***         |||  || || |||   | |  |   |  | |   |  ||    |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                     |||  || |********^ |  |   |  | |   |  ||    |  |  |                   | ||       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                     |||  || |  |||   | |  |   |  | |   |  ||    |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..                     |||  || |  ***********^***^  | |   |  ||    |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |||  || |  |||   | |         | |   *****    |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                     |*****| |  |||   | |         | |   |  |     |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |   | |  |**   | |         | |   |  |     |  |  |                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |   | |  |     | |         | |   ****     |  ****                   | |        | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***   | |  |     ***         ***            |  |  |                   ***        | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***  |                                |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                                *******                                        

Assembly 1  model: 33     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**        | |   | || |||   |    |   | | | |           |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^***         | |   | || |||   |    |   | | | |           |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | | | |          | |   | |********^    |   | | | |           |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | | | |          | |   | |  |||        |   | | | |           |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | | | |          | |   | |  ***********^***^ | | |           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  ***** | |          | |   | |  |||              | | |           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***   | |          | |   | |  |||              | | |           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |          | |   | |  |**              | | |           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |          ***   | |  |                | ***           |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..        | |                ***  |                | |             |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..        ***                  ****                ***             *******                                        

chain B : TRANSFORMING GROWTH FACTOR-BETA 1
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11848/searchPTHR11848_SF125PFAM:searchPF00019PIRSF:searchPIRSF001787PROSITE PATTERNS:searchPS00250, PROSITE PROFILES:searchPS51362, SMART:searchSM00204SUPERFAMILY:searchSSF57501UniProt:searchP01137
sec str:  .................eee........................eee...........hhhhhhhhhhhh........eeeeee.......eee..eee..........eeeee
sequence :  ..ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
seq num:  ..1         11        21        31        41        51        61        71        81        91        101         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | | | ^**        | |   | || |||   |    |   | | |             |  |  |                   |  |       | |  ^**  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | | ^***         | |   | || |||   |    |   | | |             |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | | | |          | |   | |********^    |   | | |             |  |  |                   |  |       | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | | | |          | |   | |  |||        |   | | |             |  |  |                   ^***       | |       
search RasMol script viewer Motif-ligand binding stats  TGF_BETA_1 ..  | | | | |          | |   | |  ***********^***^ | |             |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  ***** | |          | |   | |  |||              | |             |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***   | |          | |   | |  |||              | |             |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |          | |   | |  |**              | |             |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |          ***   | |  |                | |             |  |  |                              | |       
search RasMol script viewer Motif-ligand binding stats  nest ..        | |                ***  |                | |             |  |  |                              ***       
search RasMol script viewer Motif-ligand binding stats  niche ..        ***                  ****                ***             *******                                        

   New search    1kld:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML