triangle PDBeMotif: 1kil  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein    | release date: Mon, Dec 3, 2001
Title three-dimensional structure of the complexin/snare complex
Authors D.ARAC, D.TOMCHICK, E.KOVRIGIN, J.RIZO, M.MACHIUS, T.C.SUDHOF, X.CHEN
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN
Chain B sequence:
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
Chain C sequence:
GSLEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLW
Chain D sequence:
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLW
Chain E sequence:
GSKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SYNAPTOBREVIN SNARE MOTIF
member of: CATH:search1.20.5.110GENE3D:searchG3DSA_1.10.3840.10PANTHER:searchPTHR21136/searchPTHR21136_SF36PFAM:searchPF00957PIRSF:searchPIRSF005409PRINTS:searchSYNAPTOBREVNPROSITE PATTERNS:searchPS00417, PROSITE PROFILES:searchPS50892, SUPERFAMILY:searchSSF58038UniProt:searchP63045
JMol viewer RasMol script viewer  MG 301A  ..                                        *                        
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN
seq num:  ..28        38        48        58        68        78        88   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**                  |           |  |   |      |  |         |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     |           ^***   |      ^***         |  | 
search RasMol script viewer Motif-ligand binding stats  SYNAPTOBREVIN ..                     ********************                   |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            **** 

chain B : SYNTAXIN SNARE MOTIF SHORT
member of: CATH:search1.20.5.110GENE3D:searchG3DSA_1.20.5.110PANTHER:searchPTHR19957/searchPTHR19957_SF84PFAM:searchPF05739PROSITE PATTERNS:searchPS00914, PROSITE PROFILES:searchPS50192, SMART:searchSM00397SUPERFAMILY:searchSSF47661UniProt:searchP32851
JMol viewer RasMol script viewer  MG 301A  ..                                                           
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..LSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
seq num:  ..192       202       212       222       232       242      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||| ||    | ^**|             |  |        |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|| ||    | ^***             ^***        |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***  || ||    |  ||              |  |        |             
search RasMol script viewer Motif-ligand binding stats  SYNTAXIN ..     |****************************************             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****    *****              |  |                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****     ****               ****                      

chain C : SNAP-25 N-TERMINAL SNARE MOTIF
member of: CATH:search1.20.5.110GENE3D:searchG3DSA_1.20.5.110PANTHER:searchPTHR19305/searchPTHR19305_SF5PROSITE PROFILES:searchPS50192, SMART:searchSM00397SUPERFAMILY:searchSSF58038UniProt:searchP60880
JMol viewer RasMol script viewer  MG 302C  ..                                                                        
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..SLEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDL
seq num:  ..10        20        30        40        50        60        70          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |       |   |  ^**                                                   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***       |   |                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                                        

chain D : SNAP-25 C-TERMINAL SNARE MOTIF
member of: CATH:search1.20.5.110GENE3D:searchG3DSA_1.20.5.110PANTHER:searchPTHR19305/searchPTHR19305_SF5PFAM:searchPF00835/searchPF05739PROSITE PROFILES:searchPS50192, SMART:searchSM00397SUPERFAMILY:searchSSF58038UniProt:searchP60880
JMol viewer RasMol script viewer  MG 302C  ..                                                                  
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLW
seq num:  ..139       149       159       169       179       189       199   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||           ||  ||        |   |             |^*** |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**|           ||  ||        |   |             ^**|  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***           ||  ||        |   |                ^***           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                ^*****        |   |                               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 *****        |   |                               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****         |   |                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****                               

chain E : COMPLEXIN I SNARE-COMPLEX BINDING REGION
member of: CATH:search1.20.5.580GENE3D:searchG3DSA_1.20.5.580PANTHER:searchPTHR16705/searchPTHR16705_SF3PFAM:searchPF05835SUPERFAMILY:searchSSF58038UniProt:searchP63041
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI
seq num:  ..32        42        52        62         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****                             | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                              ****|
search RasMol script viewer Motif-ligand binding stats  nest ..                                      ***

   New search    1kil:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors