triangle PDBeMotif: 1k4r  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification virus    | release date: Mon, Oct 8, 2001
Title structure of dengue virus
Authors C.T.JONES, E.G.STRAUSS, E.LENCHES, J.CORVER, J.H.STRAUSS, M.G.ROSSMANN, P.R.CHIPMAN, R.J.KUHN, S.MUKHOPADHYAY, S.V.PLETNEV, T.S.BAKER, W.ZHANG
Method ELECTRON MICROSCOPY (resolution: 24.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPA
TLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGR
KTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAER
LVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTD
SGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAJOR ENVELOPE PROTEIN E
member of: GENE3D:searchG3DSA_2.60.40.350/searchG3DSA_2.60.98.10/searchG3DSA_3.30.387.10/searchG3DSA_3.30.67.10PFAM:searchPF00869/searchPF02832PIRSF:searchPIRSF003817SUPERFAMILY:searchSSF56983/searchSSF81296UniProt:searchC3V005
sec str:  ..hhhhhh...eeeee.....eeeeeee....eeeee..eeeeeeeeeeeeee..eeeeeee..eeeeeeeeee.........hhhhhh..eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee......eeeeeeee...............eeeee.....eeeee.hhh.eeeeeeehhhh.....eeeee..........eeeeehhhhhh....ee........hhhh.eee.........eee...hhhhhhhhh....eeeee..eee....eeeeeee..................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....eee..ee.eeeee...eeeeeee..eeeeeee.
sequence :  ..SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |||     ||  |||     | ||   | |  |       ||                                 |  |  || |  |   | |  || | |   |    |       |||||    |||||  | |    | |  | ^***| ||    |  | |   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| || ||   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || |||     ||  |||     | ||   | |  |       ||                                 |  |  || |  |   | |  || | |   |    |       |**^*    |||||  | |    | |  |  | || ||    |  | |   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| || ||   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||     ||  ^**     | ||   | |  |       ||                                 |  |  || |  |   ^**  || | |   |    |       | |      |||||  ^**    | |  |  | |^**|    |  ^**   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| |^**|   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |^***|     ||  ||      | ||   | |  |       ||                                 ^***  || |  |        || | |   |    |       | |      |||||         | |  |  | || ||    |  |     ^***|       || ^***| ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | ||^***|| |  ||   |^***|        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | |     ^*****      | ^***** |  |       ||                                    |  |^*****        ^*****   ^*****       | |      |||||         | |  |  | || ||    |  |      |  |       || |^*****|     |  |             |  |     |  |    | |  |  ^*****     | |       | ||^*****  | |             |  |   ^***** ||| |  ||   ||||||        ^*****         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      |||||         | |  |  | |^***    |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      *****         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      *****         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      ***||         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             ***       | || |      | |             |  |   | ||   *** |  ||   ***|||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  | |      |  |       |  |     |  |       **                                    |  |  |            | | |                | |      || ||         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |                       | || |      | |             |  |   | ||    |  |  **    |||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |      |  |       ****     ****                                             ****  |            | | |                | |      ****|         | |  |  | |  |     ****      ****       *****  |  |     |  |             |  |     |  |    | |  |                       | || |      | |             |  |   | ||    |  |        |||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |      |  |                |  |                                             |  |  |            *** |                ***       |  |         ***  |  | |  |                                 |  |     |  |             |  |     |  |    ***  |                       | || |      | |             |  |   ***|    |  |        *****                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  niche ..  ******      ****                ****                                             *******              ***                ***       ****              **** ****                                 ****     ****             ****     ****      ****                       ******      ***             ****   ****    ****                                    ******* ***                          ***       

chain B : MAJOR ENVELOPE PROTEIN E
member of: GENE3D:searchG3DSA_2.60.40.350/searchG3DSA_2.60.98.10/searchG3DSA_3.30.387.10/searchG3DSA_3.30.67.10PFAM:searchPF00869/searchPF02832PIRSF:searchPIRSF003817SUPERFAMILY:searchSSF56983/searchSSF81296UniProt:searchC3V005
sec str:  ..hhhhhh...eeeee.....eeeeeee....eeeee..eeeeeeeeeeeeee..eeeeeee..eeeeeeeeee.........hhhhhh..eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee......eeeeeeee...............eeeee.....eeeee.hhh.eeeeeeehhhh.....eeeee..........eeeeehhhhhh....ee........hhhh.eee.........eee...hhhhhhhhh....eeeee..eee....eeeeeee..................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....eee..ee.eeeee...eeeeeee..eeeeeee.
sequence :  ..SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |||     ||  |||     | ||   | |  |       ||                                 |  |  || |  |   | |  || | |   |    |       |||||    |||||  | |    | |  | ^***| ||    |  | |   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| || ||   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || |||     ||  |||     | ||   | |  |       ||                                 |  |  || |  |   | |  || | |   |    |       |**^*    |||||  | |    | |  |  | || ||    |  | |   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| || ||   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||     ||  ^**     | ||   | |  |       ||                                 |  |  || |  |   ^**  || | |   |    |       | |      |||||  ^**    | |  |  | |^**|    |  ^**   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| |^**|   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |^***|     ||  ||      | ||   | |  |       ||                                 ^***  || |  |        || | |   |    |       | |      |||||         | |  |  | || ||    |  |     ^***|       || ^***| ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | ||^***|| |  ||   |^***|        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | |     ^*****      | ^***** |  |       ||                                    |  |^*****        ^*****   ^*****       | |      |||||         | |  |  | || ||    |  |      |  |       || |^*****|     |  |             |  |     |  |    | |  |  ^*****     | |       | ||^*****  | |             |  |   ^***** ||| |  ||   ||||||        ^*****         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      |||||         | |  |  | |^***    |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      *****         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      *****         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      ***||         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             ***       | || |      | |             |  |   | ||   *** |  ||   ***|||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  | |      |  |       |  |     |  |       **                                    |  |  |            | | |                | |      || ||         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |                       | || |      | |             |  |   | ||    |  |  **    |||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |      |  |       ****     ****                                             ****  |            | | |                | |      ****|         | |  |  | |  |     ****      ****       *****  |  |     |  |             |  |     |  |    | |  |                       | || |      | |             |  |   | ||    |  |        |||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |      |  |                |  |                                             |  |  |            *** |                ***       |  |         ***  |  | |  |                                 |  |     |  |             |  |     |  |    ***  |                       | || |      | |             |  |   ***|    |  |        *****                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  niche ..  ******      ****                ****                                             *******              ***                ***       ****              **** ****                                 ****     ****             ****     ****      ****                       ******      ***             ****   ****    ****                                    ******* ***                          ***       

chain C : MAJOR ENVELOPE PROTEIN E
member of: GENE3D:searchG3DSA_2.60.40.350/searchG3DSA_2.60.98.10/searchG3DSA_3.30.387.10/searchG3DSA_3.30.67.10PFAM:searchPF00869/searchPF02832PIRSF:searchPIRSF003817SUPERFAMILY:searchSSF56983/searchSSF81296UniProt:searchC3V005
sec str:  ..hhhhhh...eeeee.....eeeeeee....eeeee..eeeeeeeeeeeeee..eeeeeee..eeeeeeeeee.........hhhhhh..eeeeeeeeeehhhhh....eeeeeeeeeeeee....eeeeee......eeeeeeee...............eeeee.....eeeee.hhh.eeeeeeehhhh.....eeeee..........eeeeehhhhhh....ee........hhhh.eee.........eee...hhhhhhhhh....eeeee..eee....eeeeeee..................eeeeeeeee.....eeeeeee.....ee..eeeee.........ee.....eee..ee.eeeee...eeeeeee..eeeeeee.
sequence :  ..SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |||     ||  |||     | ||   | |  |       ||                                 |  |  || |  |   | |  || | |   |    |       |||||    |||||  | |    | |  | ^***| ||    |  | |   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| || ||   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || |||     ||  |||     | ||   | |  |       ||                                 |  |  || |  |   | |  || | |   |    |       |**^*    |||||  | |    | |  |  | || ||    |  | |   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| || ||   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||     ||  ^**     | ||   | |  |       ||                                 |  |  || |  |   ^**  || | |   |    |       | |      |||||  ^**    | |  |  | |^**|    |  ^**   || ||       || || || ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | |||| ||| |^**|   ||||||        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |^***|     ||  ||      | ||   | |  |       ||                                 ^***  || |  |        || | |   |    |       | |      |||||         | |  |  | || ||    |  |     ^***|       || ^***| ||     |  |             |  |     |  |    | |  |  |    |     | |       | ||||   |  | |             |  |   | ||^***|| |  ||   |^***|        |    |         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | |     ^*****      | ^***** |  |       ||                                    |  |^*****        ^*****   ^*****       | |      |||||         | |  |  | || ||    |  |      |  |       || |^*****|     |  |             |  |     |  |    | |  |  ^*****     | |       | ||^*****  | |             |  |   ^***** ||| |  ||   ||||||        ^*****         |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      |||||         | |  |  | |^***    |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      *****         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      *****         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             | |       | || |      | |             |  |   | ||   ||| |  ||   ||||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |      |  |       |  |     |  |       ||                                    |  |  |            | | |                | |      ***||         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |             ***       | || |      | |             |  |   | ||   *** |  ||   ***|||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  | |      |  |       |  |     |  |       **                                    |  |  |            | | |                | |      || ||         | |  |  | |  |     |  |      |  |       || ||  |  |     |  |             |  |     |  |    | |  |                       | || |      | |             |  |   | ||    |  |  **    |||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |      |  |       ****     ****                                             ****  |            | | |                | |      ****|         | |  |  | |  |     ****      ****       *****  |  |     |  |             |  |     |  |    | |  |                       | || |      | |             |  |   | ||    |  |        |||||                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |      |  |                |  |                                             |  |  |            *** |                ***       |  |         ***  |  | |  |                                 |  |     |  |             |  |     |  |    ***  |                       | || |      | |             |  |   ***|    |  |        *****                       |  || | | |                          | |       
search RasMol script viewer Motif-ligand binding stats  niche ..  ******      ****                ****                                             *******              ***                ***       ****              **** ****                                 ****     ****             ****     ****      ****                       ******      ***             ****   ****    ****                                    ******* ***                          ***       

   New search    1k4r:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML