triangle PDBeMotif: 1k1p  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.4
Classification hydrolase    | release date: Tue, Sep 25, 2001
Title bovine trypsin-inhibitor complex
Authors M.T.STUBBS
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search MEL MEL binding statistics MEL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRYPSIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24264PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00760
JMol viewer RasMol script viewer  MEL 999A  ..                                                                              * *                                                                                         ***   *              *****       *                   
JMol viewer RasMol script viewer  CA 480A  ..                                                   * *  *                     | |                                                                                         |||   |              |||||       |                   
sec str:  ......ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhh.
sequence :  ..IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
seq num:  ..16        26        38        48        58        69        79        89        99        109       119       130       141       151       161       171       181       189       199       213       223       233          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |    | |||  |           |   || | || ||||           | || ||||          |  || ||||| |           |  |                     || | |  | |||           |^**|   | || ||    |  | |||||||| |  | ^**       | |  |         |  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    | |||  |           |   || | || ||||           | || ||||          |  || ||||| |           |  |                     || | |  ^***|           |   |   | || ||    |  | |||||||| |  |           | |  |         |  |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** |||  |           ^***** | || ||||           | || ||||          |  || ||||| |           |  |                     ^*****    | |           |   |   ^*****|    |  ^*****|||| |  |           ^*****         |  |           
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..       | |||  |               |  | ****^*|           | || ||||          |  || ||||| |           |  |                      | |      | |           |   |   | || ||    |  | |||||||| |  |             |  |         |  |           
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..       | |||  |               |  |  | |  |           | || ||||          |  || ||||| |           |  |                      | |      | |           |   |   | || ||    |  | |******^*****             |  |         |  |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||  |               |  |  | |  |           ***| ||||          |  |***|||| |           |  |                      | |      | |           |   |   | || ||    |  | |||||||| |                |  |         |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |               |  |  | ****           |  | ||||          |  |   |||| |           |  |                      | |      | |           |   |   | || ||    **** |||*******                |  |         ****           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |  |               |  |  | |  |           |  | ||||          |  |   |||***           |  |                      | |      | |           |   |   | || ||         |||||||| |                |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |               |  |  | |  |           |  | ****          |  |   ***              |  |                      | |      | |           |   |   ***| ||         |||||*** |                |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..           ****               ****  | ****           ****  ***          ****   |||              ****                      ***      ***           |   |   *******         |||||*****                ****                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                    |                                          |||                                                               *****      | |          ||||||                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                    |                                          ***                                                                          ***          ||||||                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                    *                                           *                                                                                        ******                                                

   New search    1k1p:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors