triangle PDBeMotif: 1iu6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification electron transport    | release date: Wed, Feb 27, 2002
Title neutron crystal structure of the rubredoxin mutant from pyro furiosus
Authors F.E.JENNEY, I.TANAKA, I.TSYBA, K.KURIHARA, M.W.W, N.NIIMURA, R.BAU, T.CHATAKE
Method NEUTRON DIFFRACTION (resolution: 1.60Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RUBREDOXIN
member of: CATH:search2.20.28.10GENE3D:searchG3DSA_2.20.28.10PANTHER:searchPTHR10909PFAM:searchPF00301PIRSF:searchPIRSF000071PRINTS:searchRUBREDOXINPROSITE PATTERNS:searchPS00202, PROSITE PROFILES:searchPS50903, SUPERFAMILY:searchSSF57802UniProt:searchP24297
JMol viewer RasMol script viewer  FE 153A  ..    *  *                             *  *           
sec str:  ...eeee.....eee....hhhhh.....hhhhh...........hhh.eeee.
sequence :  ..AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLE
seq num:  ..1         11        21        31        41          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |          ||||  ^*** ||  | |  ||| |^***   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |          |^***** |  ||  | |  |^*****|    
search RasMol script viewer Motif-ligand binding stats  RUBREDOXIN ..       | |          | ||  | |  ******^**^*| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |          | |**** |  ||  |    | | ****    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***          ***|  | |  ||  |    *** |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                       **** ********        ****    

   New search    1iu6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors