triangle PDBeMotif: 1iu1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification endocytosis    | release date: Tue, Feb 19, 2002
Title crystal structure of human gamma1-adaptin ear domain
Authors H.TAKATSU, K.NAKAYAMA, M.KAWASAKI, M.SUZUKI, N.IGARASHI, N.MATSUGAKI, R.KATO, S.WAKATSUKI, T.NOGI, T.SHIBA, Y.SHIBA
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SVPQISQPHFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPK
TFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAMMA1-ADAPTIN
member of: CATH:search2.60.40.1230GENE3D:searchG3DSA_2.60.40.1230PANTHER:searchPTHR22780/searchPTHR22780_SF23PFAM:searchPF02883PIRSF:searchPIRSF037094PROSITE PROFILES:searchPS50180, SMART:searchSM00809SUPERFAMILY:searchSSF49348UniProt:searchO43747
sec str:  ......eeeeee..eeeeeeeee......eeeeeeeeee......eeeeeeee.....eeee........hhhhh..eeeeeeee.........eeeeeeee..eeeeeeee....hhhhh.
sequence :  ..GIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
seq num:  ..703       713       723       733       743       753       763       773       783       793       803       813       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      ||             | ||  |        ^***|||  |      |  |               | |         | |||           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ||             | ||  |        | ^***|  |      |  |               | |         | |||           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      ||             | ||  |        *** | |  |      |  |               | |         | |||           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..      **             | ||  |        | | | |  |      |  |               | |         | |||           |  |           |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | ||  |        | | | |  |      |  |               | |         ****|           ****           ****  
search RasMol script viewer Motif-ligand binding stats  nest ..                     | ||  |        | | | |  |      |  |               ***           ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                     *******        *** | ****      ****                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                     ***              ***                                                                               

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : GAMMA1-ADAPTIN
member of: CATH:search2.60.40.1230GENE3D:searchG3DSA_2.60.40.1230PANTHER:searchPTHR22780/searchPTHR22780_SF23PFAM:searchPF02883PIRSF:searchPIRSF037094PROSITE PROFILES:searchPS50180, SMART:searchSM00809SUPERFAMILY:searchSSF49348UniProt:searchO43747
sec str:  .........eeeeee..eeeeeeeee......eeeeeeeeee......eeeeeeee.....eeee........hhhhh..eeeeeeee.........eeeeeeee..eeeeeeee....hhhhh.
sequence :  ..IAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
seq num:  ..700       710       720       730       740       750       760       770       780       790       800       810          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         ||                |  |        ^*** |          |  |        | |    | |         | |||           |  |       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         ||                |  |        | ^***          |  |        | |    | |         | |||           |  |       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..         ||                |  |        ***             |  |        | |    | |         | |||           |  |       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..         **                |  |        | |             |  |        | |    | |         | |||           |  |       |  ||  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           ****        | |             |  |        | |    | |         ****|           ****       |  |****  
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |        | |             |  |        | |    ***           ***                      |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****        ***             ****        | |                                           ****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                   ***                                                     

   New search    1iu1:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors