triangle PDBeMotif: 1ij3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription    | release date: Tue, Apr 24, 2001
Title gcn4-pvsl coiled-coil trimer with serine at the a(16) position
Authors D.L.AKEY, P.S.KIM, V.N.MALASHKEVICH
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
RMKQLEDKVEELLSKSYHLENEVARLKKLVGER
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GENERAL CONTROL PROTEIN GCN4
member of: GENE3D:searchG3DSA_1.20.5.1070PANTHER:searchPTHR11462/searchPTHR11462_SF35PFAM:searchPF00170PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF57959UniProt:searchP03069
JMol viewer RasMol script viewer  ACE 0A  ..*  *                            
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..RMKQLEDKVEELLSKSYHLENEVARLKKLVGE
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..    **********************   | |
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***

chain B : GENERAL CONTROL PROTEIN GCN4
member of: GENE3D:searchG3DSA_1.20.5.1070PANTHER:searchPTHR11462/searchPTHR11462_SF35PFAM:searchPF00170PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF57959UniProt:searchP03069
JMol viewer RasMol script viewer  ACE 0B  ..****                           
JMol viewer RasMol script viewer  ACE 0A  ..||||                           
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..RMKQLEDKVEELLSKSYHLENEVARLKKLVG
seq num:  ..1         11        21         
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..    ********************** || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        ***** |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        *******

chain C : GENERAL CONTROL PROTEIN GCN4
member of: GENE3D:searchG3DSA_1.20.5.1070PANTHER:searchPTHR11462/searchPTHR11462_SF35PFAM:searchPF00170PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF57959UniProt:searchP03069
JMol viewer RasMol script viewer  ACE 0C  ..*                              
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..RMKQLEDKVEELLSKSYHLENEVARLKKLVG
seq num:  ..1         11        21         
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..    **********************     

   New search    1ij3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML