triangle PDBeMotif: 1ifc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification lipid-binding protein    | release date: Thu, Dec 19, 1991
Title refinement of the structure of recombinant rat intestinal fa binding apoprotein at 1.2 angstroms resolution
Authors G.SCAPIN, J.C.SACCHETTINI, J.I.GORDON
Method X-RAY DIFFRACTION (resolution: 1.19Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELT
GTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTESTINAL FATTY ACID BINDING PROTEIN
member of: CATH:search2.40.128.20GENE3D:searchG3DSA_2.40.128.20PANTHER:searchPTHR11955/searchPTHR11955_SF65PFAM:searchPF00061PRINTS:searchFATTYACIDBPPROSITE PATTERNS:searchPS00214, SUPERFAMILY:searchSSF50814UniProt:searchP02693
sec str:  ..eeeeeeeeeeee.hhhhhhh....hhhhhhhhheeeeeeeee....eeeeee....eeeeee....eeeee....eeeeeeeee....eeeeee.....eeeeeeeee....eeeeee....eeeeeeeee
sequence :  ..AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |^**     | |     | ||   |  |  | |       | | ^**| | |       | ||   ||| |||   |                 | |        |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |        | |     | ||   |  |  | |       | | ^*** | |       | ||   |^***||   |                 | |        ^***      |  |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |        | |     | ||   |  ^*****       ^*****   | |       | ^***** | |^*****                 | |        |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  FABP ..   ****************** ||   |     | |       | |      | |       |  |     | |||                     | |        |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            | |     | |*****     | |       | |      | |       |  |     | |||                     | |        |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | |     | |          | |       | |      | |       |  |     | ***                     | |        |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            | |     | |          | |       | |      | |       |  |     *****                     | |        |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |     | |          | |       | |      | |       |  |     ****|                     | |        ****      ****         
search RasMol script viewer Motif-ligand binding stats  nest ..            ***     ***          ***       | |      | |       |  |       ***                     ***                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                           ***      | |       ****                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                    ***                                                                            

   New search    1ifc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML