triangle PDBeMotif: 1iev  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.2.1.58
Classification hydrolase    | release date: Wed, Apr 11, 2001
Title crystal structure of barley beta-d-glucan glucohydrolase iso exo1 in complex with cyclohexitol
Authors G.B.FINCHER, J.N.VARGHESE, M.HRMOVA, R.DEGORI
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search NAG NAG binding statistics NAG   search FUC FUC binding statistics FUC   search INS INS binding statistics INS   search MAN MAN binding statistics MAN
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1
member of: CATH:search3.20.20.300/search3.40.50.1700GB:search4566505GENE3D:searchG3DSA_3.20.20.300/searchG3DSA_3.40.50.1700PANTHER:searchPTHR30620/searchPTHR30620_SF16PFAM:searchPF00933/searchPF01915PRINTS:searchGLHYDRLASE3SUPERFAMILY:searchSSF51445/searchSSF52279UniProt:searchQ9XEI3
JMol viewer RasMol script viewer  INS 617A  ..                                                                                              *                                                *             *                                               **                                          *  *                               **                             *                                                                                                                                                                                                                                                                                              
JMol viewer RasMol script viewer  NAG 616A  ..                                                                                              |                                                |             |                                               ||                                          |  |                               ||                             |                                                                                                            *            *                                                *               *                                                                                                   
JMol viewer RasMol script viewer  MAN 615A  ..                                                                                              |                                                |             |                                               ||                                          |  |                               ||                             |                                                                                                            |            |                                                *               |                                                                                                   
JMol viewer RasMol script viewer  BMA 613A  ..                                                                                              |                                                |             |                                               ||                                          |  |                               ||                             |                                                                                                            |            |                                                |               |                                                                                                   
JMol viewer RasMol script viewer  NAG 612A  ..                                                                                              |                                                |             |                                               ||                                          |  |                               ||                             |                                                                                                            |            |                                                |               |                                                                                                   
JMol viewer RasMol script viewer  NAG 611A  ..                                                                                              |                                                |             |                                               ||                                          |  |                               ||                             |                                                                                                            |            |                                                |        * *    |                                                                                                   
JMol viewer RasMol script viewer  FUC 614A  ..                                                                                              |                                                |             |                                               ||                                          |  |                               ||                             |                                                                                                            |            |                                                |        | |    |                                                                                                   
JMol viewer RasMol script viewer  NAG 610A  ..                                                                                              |                                                |             |                                               ||             **                           |  | *                             ||                             |                                                                                                            |            |                                                |        | |    |                                                                                                   
sec str:  ....hhhhh...hhhhhhhhhhh..hhhhhhhhheeee.hhhhhhhhhhh...eee...........hhhhhhhhhhhhhhhhhh.......eeee................hhhhhhh..hhhhhhhhhhhhhhhhhh....ee..............hhhhh...hhhhhhhhhhhhhhhhh.....................eeeee.hhhhhhhhh...ee..hhhhhhhhhhhhhhhhhh....eeee...ee..ee...hhhhhh...........eee.....hhhhh.....hhhhhhhhhhhhh...ee...hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh........hhhhhhhh.hhhhhhhhhhhhhhhheeeee.................eeeee.....hhhhhhh.................hhhhhhhhhh....eeeee...hhhhhhh.....eeeeee....hhhhhh.........hhhhhhhhhhhh.eeeeee......hhhhhhhh.eeee.......hhhhhhhhh...............hhhhh........................
sequence :  ..DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKACMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKNAMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNKYQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYAIVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGDFGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNAT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  | ||        || |||  || |  |  ||  |       | ||    |  |  |  || ||          || |||| |           |  |  |       ||  ||| |    |   |  ||| |||   |  | |   | ||| |  | |||     ||||||       |  ||  |    |  |         |||||   |  ^***                   | |     | |     || || | | |    ||||     || |||| || | |||  || | |  | |                  || ||||| ||||       |   ||||| | | | ||| || |           |  |  ||   | |||| |  | |       || ||         | |    | |     |  |  |  || |||       | | | || |            ||||||  ^*** |         || |  |    | |      ||  |            |    || |||| ||||       || ||  |  |     |||  ||   ^**
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | ||        || |||  || |  |  ||  |       | ||    |  |  |  |^**|          || ^**| |           |  |  |       ||  ||| |    |   |  ||| |||   |  | |   | ||| |  | |||     ||||||       |  ||  |    |  |         |||||   |                         | |     | |     || || | | |    ^**|     || |||| || | |||  |^** |  | |                  || ||||| ||||       |   ||||| | | | ||| || |           |  |  ||   | |||| |  | |       || ||         | |    ^**     |  |  |  || |||       | | | || |            ||||||  | |  |         || |  |    ^**      ||  |            |    || |||| |^**       || ||  |  |     |||  ||    |^
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  | ||        || ||^***| |  ^***|  |       | ||    |  |  |  |^***          || || | |           |  |  |       ||  ||| |    |   ^***|| |||   |  | |   | ||| |  ^***|     ^***||       |  ||  |    |  |         |||||   |                         | |     | |     || || | | |    || |     ^***||| || | |||  ||   |  | |                  || ||||| ^***       |   ||||| | | | ||| || |           |  |  ||   ^***|| |  | |       |^***         | |            ^***  |  || |||       | | | || |            ||^***  | ^***         || |  |             ||  |            |    || |||| | |        || ||  |  |     |||  ||    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  | ||        || |||   | |  |   |  |       | |^*****  |  |  |              || || | |           |  |  |       ^*****| |    |   |   || |^*****  | |   | ||| |  | | |      || ||       |  ||  |    |  |         |||^*****                         | |     | |     || || | | |    || |      | |||| || | ^*****|   |  | |                  || |||||  ||        |   ||||| | | | ||| || |           |  |  ||   | |||| |  | |       |  |          | |                  |  || |||       | | | || |            ||||||  | |            |^*****             ||  |            ^*****| |||| | |        || ||  |  |     |||  |^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  | ||        *****|   | |  |   |  |       | |     |  |  |  |              || || | |           |  |  |        |  | | |    |   |   || |||      | |   | ||| |  | | |      || ||       |  ||  |    |  |         |||||                             | |     | |     || || | | |    || |      | |||| || | |||   |   |  | |                  || ||||*****        |   ||||| | | | ||| || |           |  |  ||   | |||| |  | |       |  |          | |                  |  || |||       | | | || |            ||||||  | |            |  |                ||  |                  | |||| | |        || ||  |  |     |||  |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  | ||        || |||   | |  |   |  |       | |     |  |  |  |              || || | |           |  |  |        |  | | |    |   |   || |||      | |   ***** |  | | |      || ||       |  ||  |    |  |         |||||                             | |     | |     || |***** |    || |      | |||| || | |||   |   |  | |                  || |||||  |         |   ||||| | | | ||| || |           |  |  ||   | |||| |  | |       |  |          | |                  |  |*****       | | | || |            ||||||  | |            |  |                ||  |                  | |||| | |        || ||  |  |     |||  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  ***|        || |||   | |  |   |  |       | |     |  |  |  |              || || | |           |  |  |        |  | ***    |   |   || |||      | |   ***|  |  | | |      || ||       |  ||  |    |  |         |||||                             | |     | |     || |***   |    || |      | |||| || | |||   |   |  | |                  || |||||  |         |   ||||| | | ***|| || |           |  |  ||   | |||| |  | |       |  |          | |                  |  |***|        *** | || |            ||||||  ***            |  |                ||  |                  | |||| | |        || ||  |  |     |||  |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  |  |        || |||   | |  |   |  |       | |     |  |  |  |              || || | |           |  |  |        |  | |      |   |   || |||      | |   |  |  |  | | |      || ||       |  ||  |    |  |         |||||                             | |     | |     || ||     |    || |      | |||| || | |||   |   |  | |                  || |||||  |         |   ||||| | |    || || |           |  |  **   | |||| |  | |       |  |          | |                  |  ||  |          | | || |            ||||||  | |            |  |                ||  |                  | |||| | |        || ||  |  |     **|  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  |        *****|   | |  |   ****       | |     ****  |  |              ****| | |           |  |  |        **** |      |   |   *****|      | |   ****  **** | |      *****       |  |****    |  |         ****|                             | |     | |     ****|     |    || |      ********| ****|   |   |  | |                  |****||****         |   ||||| | |    ****| |           |  |       ****|| |  | |       ****          | |                  |  |****          | **** |            *****|  | |            |  |                ||  |                  ****|| | |        ****|  ****       ****       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |  |         |  ||   | |  |   |  |       | |     |  |  |  |               |  | | |           |  |  |           | |      |   |      | |      | |   |  |  |  | | |                  |  ||  |    |  |         ||| |                             | |     | |      |  |     |    || |        | ||  |   | |   |   |  | |                  |  ||||             |   ||||| | |     | || |           |  |       | |||| |  | |                     ***                  |  ||  |          |   || |              |  |  | |            |  |                ||  |                    |||| | |         |  |  |  |       |  |       
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |         |  ||   | |  |   |  |       ***     |  |  |  |               |  | ***           |  |  |           ***      |   |      ***      | |   |  |  |  | | |                  |  ||  |    |  |         *** |                             ***     | |      |  |     |    |***        ***|  |   ***   |   |  ***                  |  ****             |   |**** | |     | || |           |  |       | |||| |  | |                                          |  ||  |          |   |***              |  |  ***            |  |                ||  |                    **** | |         |  |  |  |       |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..   *******         ****|   | ****   ****               ****  ****               ****               *******           | |      |   |               ***   ****  **** ***                  ********    ****          ****                                     ***      ****     |    |              ****         |   |                       |    |              |   |     ***     ******           ****       ****|***  ***                                          ********          |   |                 ****                 ****                |****                         ***         ****  ****       ****       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       |   |                                                                                         | |      |   |                                | |                                                                                                       |    |                           |   |                       ******              |   |                                         | | |                                                                    |   |                                                          |   |                                                                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       *****                                                                                         | |      |   |                                | |                                                                                                       |    |                           |   |                                           |   |                                         *****                                                                    |   |                                                          |   |                                                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                     | |      *****                                | |                                                                                                       ******                           *****                                           *****                                         | |                                                                      *****                                                          *****                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                     ***                                           ***                                                                                                                                                                                                                                      ***                                                                                                                                                                                                           

   New search    1iev:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML