triangle PDBeMotif: 1ich  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification apoptosis    | release date: Sun, Apr 1, 2001
Title solution structure of the tumor necrosis factor receptor-1 death domain
Authors G.-Y.XU, K.MALAKIAN, L.-L.LIN, R.POWERS, S.F.SUKITS
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAHKPQSLDTDDPATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGR
VLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR NECROSIS FACTOR RECEPTOR-1
member of: CATH:search1.10.533.10GENE3D:searchG3DSA_1.10.533.10PANTHER:searchPTHR23097/searchPTHR23097_SF110PFAM:searchPF00531PRINTS:searchTNFACTORR1APROSITE PROFILES:searchPS50017, SMART:searchSM00005SUPERFAMILY:searchSSF47986UniProt:searchP19438
sec str:  ..hhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.hhhhhhhhhhhhh
sequence :  ..PATLYAVVENVPPLRWKEFVKRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALC
seq num:  ..327       337       347       357       367       377       387       397       407    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |  || | |  ||| |||||||  ||  |   | ||   | ||| || **^* |  | ||  |||||||||| |||  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  || | |  ||| |||||||  ||  |   | ||   | ||| |^**| ^**  | ||  |||||||||| |||  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  || | |  ||| ||||||^***|  |   | ||   | ||| ||  | |    | ||  |||||||||| |||  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    |  || | |  ||| ||||||    |  |   | *******^|| ||  | |    | ||  |||||||||| |||  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ***** | |  |********|    |  |   |  |   ********  | |    | |**********|**********   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****  | ************|    ****   |  |   *******   | |    | |**** ********** ****    
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |           ***           |  |             | |    ***      |  ****           
search RasMol script viewer Motif-ligand binding stats  niche ..       ****                         ****             ***             |    |            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                     ******            

   New search    1ich:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML