triangle PDBeMotif: 1i7h  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification electron transport    | release date: Fri, Mar 9, 2001
Title crystal sturcuture of fdx
Authors K.FUKUYAMA, T.HORIO, Y.KAKUTA, Y.TAKAHASHI
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search FES FES binding statistics FES
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE
PESRLSCQARVTDEDLVVEIPRYTINHAREH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FERREDOXIN
member of: CATH:search3.10.20.30GENE3D:searchG3DSA_3.10.20.30PANTHER:searchPTHR23426/searchPTHR23426_SF17PFAM:searchPF00111PRINTS:searchADRENODOXINPROSITE PATTERNS:searchPS00814, PROSITE PROFILES:searchPS51085, SUPERFAMILY:searchSSF54292TIGRFAMS:searchTIGR02007UniProt:searchP0A9R4
JMol viewer RasMol script viewer  FES 1112A  ..                                      * * * ***  *                                 * *                       
sec str:  ...eeee..........eeee.....hhhhhhhhh.................eeeeeehhhhh...hhhhhhhhh........eee..........eeee...........
sequence :  ..PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHARE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |     |  |^***  | ||| |   | |||||| ||     |||^*** ^***  || ||  ||  | || ||  ^***          |  | 
search RasMol script viewer Motif-ligand binding stats  ADX ..           |  |     |  |      | ||| |   ^*****^**^*     |||||         || ||  ||  | || ||                |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |     |  |      | ||| |   | ||||||  |     |||||         *****  ||  | *****                |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****     |  |      ****| |   | ||||||  |     ****|         *****  |**** ****|                **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |  |        | ***   | ||||||  |     ||| |          |  |  ||  |  |  |                |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  |        ***     *******|  |     *** |          |  |  ||  |  |  |                |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****                       ****      ****          ***********  ****                **** 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : FERREDOXIN
member of: CATH:search3.10.20.30GENE3D:searchG3DSA_3.10.20.30PANTHER:searchPTHR23426/searchPTHR23426_SF17PFAM:searchPF00111PRINTS:searchADRENODOXINPROSITE PATTERNS:searchPS00814, PROSITE PROFILES:searchPS51085, SUPERFAMILY:searchSSF54292TIGRFAMS:searchTIGR02007UniProt:searchP0A9R4
JMol viewer RasMol script viewer  FES 2112B  ..                                      * * * ***  *                                 * *                       
sec str:  ...eeee..........eeee.....hhhhhhhh..................eeeeeehhhhh...hhhhhhhhh........eee..........eeee...........
sequence :  ..PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHARE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |     |  |^*** |  | | |   | |||||| ||   |||||^*** ^***| || ||  ||  | || ||  ^***          | |  
search RasMol script viewer Motif-ligand binding stats  ADX ..           |  |     |  |     |  | | |   ^*****^**^*   ||||| |   |   | || ||  ||  | || ||                | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |     |  |     |  | | |   | ||||||  |   ||||| |   |   | *****  ||  | *****                | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |     |  |     |  | | |   | ||||||  |   ||||| |   |   | || ||  ||  | || ||                ***  
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |     |  |     |  | | |   | ||||||  |   **||| |   |   | || ||  ||  | || ||                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****     |  |     **** | |   | ||||||  |     ||| |   |   | ****|  |**** ****|                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |  |        | ***   | ||||||  |     ||| |   |   |  |  |  ||  |  |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  |        ***     *******|  |     *** |   |   |  |  |  ||  |  |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****                       ****      ****   |   |  ***********  ****                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                *****                                        

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : FERREDOXIN
member of: CATH:search3.10.20.30GENE3D:searchG3DSA_3.10.20.30PANTHER:searchPTHR23426/searchPTHR23426_SF17PFAM:searchPF00111PRINTS:searchADRENODOXINPROSITE PATTERNS:searchPS00814, PROSITE PROFILES:searchPS51085, SUPERFAMILY:searchSSF54292TIGRFAMS:searchTIGR02007UniProt:searchP0A9R4
JMol viewer RasMol script viewer  FES 3112C  ..                                      * * * ***  *                                 * *                      
sec str:  ...eeee..........eeee.....hhhhhhhhh.................eeeeeehhhhh...hhhhhhhhh........eee..........eeee..........
sequence :  ..PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |     |  |^***    | | |   | |||||| ||     |||^*** ^***| || ||  ||  | || ||  ^***          | | 
search RasMol script viewer Motif-ligand binding stats  ADX ..           |  |     |  |        | | |   ^*****^**^*     |||||   |   | || ||  ||  | || ||                | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |     |  |        | | |   | ||||||  |     |||||   |   | *****  ||  | *****                | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |     |  |        | | |   | ||||||  |     |||||   |   | || ||  ||  | || ||                *** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****     ****        | | |   | ||||||  |     ****|   |   | *****  |**** ****|                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |  |        | ***   | ||||||  |     ||| |   |   |  |  |  ||  |  |  |                    
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  |        ***     *******|  |     *** |   |   |  |  |  ||  |  |  |                    
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****                       ****      ****   |   |  ***********  ****                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                *****                                       

   New search    1i7h:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML