triangle PDBeMotif: 1i44  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.112
Classification transferase    | release date: Mon, Feb 19, 2001
Title crystallographic studies of an activation loop mutant of the insulin receptor tyrosine kinase
Authors A.J.ABLOOGLU, J.H.TILL, M.FRANKEL, R.A.KOHANSKI, S.R.HUBBARD
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search ACP ACP binding statistics ACP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARN
CMVAHDFTVKIGDFGMTRDIYETAYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN RECEPTOR
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24416/searchPTHR24416_SF140PFAM:searchPF07714PIRSF:searchPIRSF000620PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109/searchPS00239, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF56112UniProt:searchP06213
JMol viewer RasMol script viewer  ACP 300A  ..                * ***   *                 * *                                              ***                                                           *          *    ..ACP ..                                                                                                                 
JMol viewer RasMol script viewer  MG 301A  ..                | |||   |                 | |                                              |||                                                           |          *    ..MG ..                                                                                                                 
sec str:  ........hhh.eeeeeeeee....eeeeeeee.......eeeeeeee.....hhhhhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......... ...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..hhhhhh...hhhhh
sequence :  ..PDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMT... ..LPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
seq num:  ..986       996       1006      1016      1026      1036      1046      1056      1066      1076      1086      1096      1106      1116      1126      1136      1146     ... ..1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      1271         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||  |  |  || ||             | |  |       || ^***| ||          |  | |  |      | |              |   | || |  |  |      | ||              || ||| | | ||||| || ||| |       ..PS00001.. || ||   | |||| ||| |       ||  || ||| || ||   | ||| ||||                |  | ||||| |  ||    |  |  | || ||  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||  |  |  || ||             | |  |       || ||||^**|          |  | |  |      | |              |   | |^**  |  |      | ||              || ||| | | ||||| || ||^**       ..PS00005.. || ||   ^**||| ||| |       ||  || ||| || ||   | ||| ||||                |  | ||||| |  ||    |  |  | || ||  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| ||  |  |  || ||             | |  |       |^***||^***          |  | |  |      | |              |   | |  |  |  |      ^***              || ||| | | ||||| || |||         ..PS00006.. || ||   ^***|| |^***       ||  |^***| || ||   | ||| ||||                |  | ||||| ^***|    |  |  ^*** ||  | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|| ||  |  |  || ||             | |  |       |  | ||              |  | |  |      | |              |   | |  |  |  |      | |               || ||| | | ||||| || |||         ..PS00007.. || ||      ||| | | |       ||  || | | || ||   | *******^                |  | ||||| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||  |  |  || ||             | |  |       |  | ||              |  | |  |      | |              |   | |  |  |  |      | |               || ||| | | ||||| || |||         ..PS00008.. || ||      |^***** |       ||  || | | || ||   |  || |||                 |  | ||||| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..|| ||  |  |  || *****************************  | ||              |  | |  |      | |              |   | |  |  |  |      | |               || ||| | | ||||| || |||         ..PS00107.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | ||||| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..|| ||  |  |  || ||             | |  |          | ||              |  | |  |      | |              |   | |  |  |  |      | |               || ||****^********| |||         ..PS00109.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | ||||| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  RECEPTOR_TYR_KIN_II ..|| ||  |  |  || ||             | |  |          | ||              |  | |  |      | |              |   | |  |  |  |      | |               || ||| | | |||||  | |||         ..PS00239.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | ||||| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****  |  |  || ||             | |  |          | ||              |  | |  |      | |              |   | |  |  |  |      | |               || ||| | | |||||  | |||         ..alphabetamotif.. *****      | | |   |       ||  || | | || ||   |  || |||                 |  | ||||| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|| ||  |  |  || ||             | |  |          | ||              |  | |  |      | |              ***** |  |  |  |      | |               || ||| | | |||||  | |||         ..asxmotif.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | ***** |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| ||  |  |  || ||             | |  |          ***|              |  | |  |      | |                    |  |  |  |      | |               || ||| | | |||||  | |||         ..asxturn.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | ***|| |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..|| ||  |  |  ** **             | |  |          |  |              |  | |  |      | |                    |  |  |  |      | |               || ||| | | |||||  | |||         ..betabulge.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | || || |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..|| ||  |  |                    | |  |          |  |              |  | |  |      | |                    |  |  |  |      | |               || ||| | | |||||  *****         ..betabulgeloop.. || ||      | | |   |       ||  || | | || ||   |  || |||                 |  | || || |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|  |  |                    | ****          |  |              **** |  |      | |                    |  ****  |      | |               |****| | | *****  ****|         ..betaturn.. ****|      | | |   |       ||  || | | ****|   |  |****|                 |  | ****| |   |    |  |    |  |**** |  
search RasMol script viewer Motif-ligand binding stats  nest .. |  |  |  |                    ***  |          |  |              |  | |  |      | |                    |  |  |  |      | |               |  *** ***  || |    ***         ..nest..  |  |      *** |   |       ||  |*** | || ||   |  |  ***                 |  | ||  | |   |    |  |    |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  niche .. ****  ****                      ****          ****              **** ****      ***                    **********      | |               |    |   |  ****                ..niche..  ****          |   |       ||  ||   ******|   |  |    |                 ********** |   |    ****    ******** |  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                       | |               ******   |   |                  ..schellmannloop..                |   |       ||  ||         |   |  ******                            |   |                   | |  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                       | |                        |   |                  ..stmotif..                *****       ||  ||         *****                                    *****                   | |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                       | |                        |   |                  ..ststaple..                            ******                                                                          | |  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                       ***                        |   |                  ..stturn..                                                                                                            ***  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                  *   *                  ..REP00000..                                                                                                                 

   New search    1i44:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors